1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Sialidase-1 Protein, Human (HEK293, His)

The Sialidase-1 protein plays a crucial role in cellular processes by catalyzing the removal of the sialic acid (N-acetylneuraminic acid) moiety from glycoproteins and glycolipids. Its enzymatic activity is strictly dependent on its presence in multienzyme complexes, emphasizing the cooperative nature of its function. Sialidase-1 Protein, Human (HEK293, His) is the recombinant human-derived Sialidase-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Sialidase-1 protein plays a crucial role in cellular processes by catalyzing the removal of the sialic acid (N-acetylneuraminic acid) moiety from glycoproteins and glycolipids. Its enzymatic activity is strictly dependent on its presence in multienzyme complexes, emphasizing the cooperative nature of its function. Sialidase-1 Protein, Human (HEK293, His) is the recombinant human-derived Sialidase-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Sialidase-1 protein is an enzyme that catalyzes the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins and glycolipids. Its activity is strictly dependent on its presence within a multienzyme complex. Sialidase-1 exhibits a preference for cleaving alpha 2-3 and alpha 2-6 sialyl linkages, indicating its specificity towards particular types of sialic acid modifications. By removing sialic acid residues, Sialidase-1 plays a crucial role in modulating the structure and function of glycoconjugates, impacting cellular interactions, immune recognition, and various signaling pathways. The enzyme's preference for specific sialyl linkages suggests its involvement in regulating distinct biological processes influenced by sialic acid modifications.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q99519 (E48-L415)

Gene ID
Molecular Construction
N-term
Sialidase-1 (E48-L415)
Accession # Q99519
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Sialidase-1; Acetylneuraminyl Hydrolase; G9 Sialidase; Lysosomal Sialidase; N-Acetyl-Alpha-Neuraminidase 1; NEU1; NANH
AA Sequence

ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

Molecular Weight

39-50 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 10% Glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Sialidase-1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Sialidase-1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71310
Quantity:
MCE Japan Authorized Agent: