1. Recombinant Proteins
  2. Others
  3. SFRP1 Protein, Mouse (CHO, His)

SFRP1 Protein is a secreted glycoprotein member of the SFRP family.SFRP1 Protein can act as an inhibitor of Wnt signaling and is capable of resisting vascular cell proliferation.SFRP1 Protein, Mouse (CHO, His) is the recombinant mouse-derived SFRP1 protein, expressed by CHO , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE SFRP1 Protein, Mouse (CHO, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SFRP1 Protein is a secreted glycoprotein member of the SFRP family.SFRP1 Protein can act as an inhibitor of Wnt signaling and is capable of resisting vascular cell proliferation.SFRP1 Protein, Mouse (CHO, His) is the recombinant mouse-derived SFRP1 protein, expressed by CHO , with C-10*His labeled tag.

Background

SFRP1 protein is an inhibitor of Wnt signaling, which can inhibit WNT1/WNT4-mediated TCF-dependent transcription. SFRP1 protein can reduce intracellular beta-catenin levels.SFRP1 Protein has anti-proliferative effects on vascular cells in vitro and in vivo, and can induce angiogenesis in vivo. In the vascular cell cycle, SFRP1 Protein delays the G1 phase and enters the S phase. In kidney development, SFRP1 Protein inhibits the formation of posterior renal tubules and the growth of buds. SFRP1 Protein plays a key role in maintaining the function of hematopoietic stem cells (HSC). SFRP1 Protein is a multifunctional regulator of intercellular communication, and can be used as a potential target for treating chronic inflammation in neurodegenerative diseases[1][2]

Biological Activity

Measured by its ability to inhibit Topflash reporter activity in HEK293T human embryonic kidney cells. The ED50 for this effect is typically 0.4-2 μg/mL in the presence of 300 ng/mL of Recombinant Mouse Wnt-3a.

Species

Mouse

Source

CHO

Tag

C-10*His

Accession

AAC53145.1 (S32-K314)

Gene ID
Molecular Construction
N-term
SFRP1 (S32-K314)
Accession # AAC53145.1
10*His
C-term
Protein Length

Partial

Synonyms
FRP1; FrzA; SARP-2; secreted frizzled-related protein 1; sFRP1
AA Sequence

SEYDYVSFQSDIGSYQSGRFYTKPPQCVDIPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNTTEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKALVLFLKNGADCPCHQLDNLSHNFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKRMKNHECPTFQSVFK

Molecular Weight

Approximately 32.6 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SFRP1 Protein, Mouse (CHO, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SFRP1 Protein, Mouse (CHO, His)
Cat. No.:
HY-P73413
Quantity:
MCE Japan Authorized Agent: