SF20/MYDGF Protein, Mouse

SF20/MYDGF protein promotes cardiac myocyte survival and adaptive angiogenesis after myocardial infarction (MI). It stimulates endothelial cell proliferation via MAPK1/3, STAT3, and CCND1 signaling, and inhibits cardiac myocyte apoptosis through PI3K/AKT signaling. Given its ability to enhance cardiac function and angiogenesis, SF20/MYDGF protein could be a valuable therapeutic target for improving outcomes in MI patients. SF20/MYDGF Protein, Mouse is the recombinant mouse-derived SF20/MYDGF, expressed by E. coli, with tag Free labeled tag.

SF20/MYDGF protein is a bone marrow-derived monocyte and paracrine-acting protein that plays a crucial role in promoting cardiac myocyte survival and adaptive angiogenesis for cardiac protection and repair following myocardial infarction (MI). It exerts its effects by stimulating endothelial cell proliferation through a signaling pathway involving MAPK1/3, STAT3, and CCND1. Additionally, SF20/MYDGF protein inhibits cardiac myocyte apoptosis through a signaling pathway dependent on PI3K/AKT. This protein's ability to enhance cardiac function and promote angiogenesis makes it a potential therapeutic target for treating MI and improving cardiac outcomes.

Measured by its binding ability in a functional ELISA. When Recombinant Mouse SF20 is used at 2 μg/mL can bind Recombinant Human P4HB. The ED₅₀ for this effect is 0.681 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Mouse SF20 is used at 2 μg/mL can bind Recombinant Human P4HB. The ED₅₀ for this effect is 0.681 μg/mL.

Mouse

E. coli

Tag Free

Q9CPT4 (V25-L166)

28106  [NCBI]

Full Length of Mature Protein

VSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL

Approximately 16 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.