1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. SF20/MYDGF Protein, Mouse

SF20/MYDGF protein promotes cardiac myocyte survival and adaptive angiogenesis after myocardial infarction (MI). It stimulates endothelial cell proliferation via MAPK1/3, STAT3, and CCND1 signaling, and inhibits cardiac myocyte apoptosis through PI3K/AKT signaling. Given its ability to enhance cardiac function and angiogenesis, SF20/MYDGF protein could be a valuable therapeutic target for improving outcomes in MI patients. SF20/MYDGF Protein, Mouse is the recombinant mouse-derived SF20/MYDGF, expressed by E. coli, with tag-free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SF20/MYDGF protein promotes cardiac myocyte survival and adaptive angiogenesis after myocardial infarction (MI). It stimulates endothelial cell proliferation via MAPK1/3, STAT3, and CCND1 signaling, and inhibits cardiac myocyte apoptosis through PI3K/AKT signaling. Given its ability to enhance cardiac function and angiogenesis, SF20/MYDGF protein could be a valuable therapeutic target for improving outcomes in MI patients. SF20/MYDGF Protein, Mouse is the recombinant mouse-derived SF20/MYDGF, expressed by E. coli, with tag-free.

Background

SF20/MYDGF protein is a bone marrow-derived monocyte and paracrine-acting protein that plays a crucial role in promoting cardiac myocyte survival and adaptive angiogenesis for cardiac protection and repair following myocardial infarction (MI). It exerts its effects by stimulating endothelial cell proliferation through a signaling pathway involving MAPK1/3, STAT3, and CCND1. Additionally, SF20/MYDGF protein inhibits cardiac myocyte apoptosis through a signaling pathway dependent on PI3K/AKT. This protein's ability to enhance cardiac function and promote angiogenesis makes it a potential therapeutic target for treating MI and improving cardiac outcomes.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Mouse SF20 is used at 2 μg/mL can bind Recombinant Human P4HB. The ED50 for this effect is 0.681 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Mouse SF20 is used at 2 μg/mL can bind Recombinant Human P4HB. The ED50 for this effect is 0.681 μg/mL.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q9CPT4 (V25-L166)

Gene ID
Molecular Construction
N-term
SF20 (V25-L166)
Accession # Q9CPT4
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-25; IL-25; Interleukin-17E; IL-17E; SF20
AA Sequence

VSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SF20/MYDGF Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SF20/MYDGF Protein, Mouse
Cat. No.:
HY-P73303
Quantity:
MCE Japan Authorized Agent: