1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. SF20/MYDGF Protein, Human (HEK293, His)

The MYDGF protein is derived from bone marrow mononuclear cells and significantly promotes cardioprotection and post-myocardial infarction (MI) repair. Its functions include promoting cardiomyocyte survival and promoting adaptive angiogenesis. SF20/MYDGF Protein, Human (HEK293, His) is the recombinant human-derived SF20/MYDGF protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MYDGF protein is derived from bone marrow mononuclear cells and significantly promotes cardioprotection and post-myocardial infarction (MI) repair. Its functions include promoting cardiomyocyte survival and promoting adaptive angiogenesis. SF20/MYDGF Protein, Human (HEK293, His) is the recombinant human-derived SF20/MYDGF protein, expressed by HEK293 , with C-His labeled tag.

Background

MYDGF Protein, a paracrine-acting protein derived from bone marrow monocytes, plays a crucial role in cardiac protection and repair following myocardial infarction (MI). Its multifaceted functions include the promotion of cardiac myocyte survival and the facilitation of adaptive angiogenesis. MYDGF stimulates endothelial cell proliferation through a signaling pathway involving MAPK1/3, STAT3, and CCND1. Additionally, it inhibits cardiac myocyte apoptosis through a PI3K/AKT-dependent signaling pathway. The protein's involvement in endothelial cell proliferation and angiogenesis underscores its significance in mediating processes crucial for cardiac recovery and tissue repair, making it a potential therapeutic target for cardiovascular conditions.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human SF20/MYDGF is immobilized at 2 μg/mL. Recombinant Human P4HB binds with an ED50 of 2.292 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human SF20/MYDGF is immobilized at 2 μg/mL, Recombinant Human P4HB binds with an ED50 of 2.292 μg/mL.
Species

Human

Source

HEK293

Tag

C-His

Accession

Q969H8 (V32-L173)

Gene ID
Molecular Construction
N-term
SF20 (V32-L173)
Accession # Q969H8
His
C-term
Synonyms
Myeloid-derived growth factor; MYDGF; C19orf10
AA Sequence

VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL

Molecular Weight

Approximately 17.3 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SF20/MYDGF Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SF20/MYDGF Protein, Human (HEK293, His)
Cat. No.:
HY-P700641
Quantity:
MCE Japan Authorized Agent: