1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Serpin (Protease Inhibitor)
  5. Alpha-1 Antitrypsin 1
  6. Serpin A1 Protein, Rat (HEK293, His)

The serpin A1 protein is a vigilant guardian in cell regulation, effectively inhibiting elastase and providing a strong barrier to its enzymatic activity.Serpin A1 has moderate affinity for plasmin and thrombin and exhibits versatility in binding a range of serine proteases.Serpin A1 Protein, Rat (HEK293, His) is the recombinant rat-derived Serpin A1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The serpin A1 protein is a vigilant guardian in cell regulation, effectively inhibiting elastase and providing a strong barrier to its enzymatic activity.Serpin A1 has moderate affinity for plasmin and thrombin and exhibits versatility in binding a range of serine proteases.Serpin A1 Protein, Rat (HEK293, His) is the recombinant rat-derived Serpin A1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Serpin A1, a vigilant guardian in the intricate landscape of cellular regulation, stands as a potent inhibitor of serine proteases. Its primary target is elastase, where it acts as a formidable shield against enzymatic activity. Moreover, Serpin A1 exhibits a moderate affinity for plasmin and thrombin, showcasing its versatility in engaging with a spectrum of serine proteases. In its regulatory role, Serpin A1 establishes intricate interactions with CELA2A, ERGIC3, LMAN1/ERGIC53, and PRSS1/Trypsin, contributing to the nuanced orchestration of proteolytic processes within the cellular milieu.

Biological Activity

Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2. The IC50 value is 2.931 nM, as measured under the described conditions.

Species

Rat

Source

HEK293

Tag

C-His

Accession

P17475 (E25-R411)

Gene ID
Molecular Construction
N-term
Serpin A1 (E25-R411)
Accession # P17475
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Alpha-1-antiproteinase; Serpin A1; A1A
AA Sequence

EDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQHLEQTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDPTR

Molecular Weight

Approximately 50-60 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Serpin A1 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Serpin A1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74556
Quantity:
MCE Japan Authorized Agent: