1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Serpin (Protease Inhibitor)
  5. Pigment Epithelium Derived Factor
  6. Serpin F1 Protein, Human (HEK293, His)

Serpin F1 protein, a neurotrophic factor, crucially promotes extensive neuronal differentiation in retinoblastoma cells and serves as a potent inhibitor of angiogenesis. Unlike active serpins, Serpin F1 does not undergo the typical S (stressed) to R (relaxed) conformational transition, lacking serine protease inhibitory activity. It also interacts with PNPLA2, enhancing the phospholipase A2 activity of PNPLA2. Serpin F1 Protein, Human (HEK293, His) is the recombinant human-derived Serpin F1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Serpin F1 protein, a neurotrophic factor, crucially promotes extensive neuronal differentiation in retinoblastoma cells and serves as a potent inhibitor of angiogenesis. Unlike active serpins, Serpin F1 does not undergo the typical S (stressed) to R (relaxed) conformational transition, lacking serine protease inhibitory activity. It also interacts with PNPLA2, enhancing the phospholipase A2 activity of PNPLA2. Serpin F1 Protein, Human (HEK293, His) is the recombinant human-derived Serpin F1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Neurotrophic protein Serpin F1 plays a pivotal role in promoting extensive neuronal differentiation in retinoblastoma cells. Additionally, it functions as a potent inhibitor of angiogenesis. Notably, Serpin F1 does not undergo the S (stressed) to R (relaxed) conformational transition typical of active serpins, resulting in the absence of serine protease inhibitory activity. Furthermore, it interacts with PNPLA2, fostering the phospholipase A2 activity of PNPLA2.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P36955 (Q20-P418)

Gene ID
Molecular Construction
N-term
Serpin F1 (Q20-P418)
Accession # P36955
6*His
C-term
Synonyms
Pigment Epithelium-Derived Factor; PEDF; Cell Proliferation-Inducing Gene 35 Protein; EPC-1; Serpin F1; SERPINF1; PEDF
AA Sequence

QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

Molecular Weight

Approximately 50.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Serpin F1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Serpin F1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70498
Quantity:
MCE Japan Authorized Agent: