1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Serpin (Protease Inhibitor)
  5. Kallistatin
  6. Serpin A4 Protein, Human (HEK293, His)

Serpin A4 Protein inhibits tissue kallikrein's amidolytic and kininogenase activities by forming a heat- and SDS-stable equimolar complex with the enzyme. Tissue kallikrein concurrently cleaves the reactive site of Serpin A4, producing a small C-terminal fragment. The protein, existing as a monomer and occasionally forming homodimers, demonstrates its regulatory role in modulating tissue kallikrein-mediated enzymatic activities. Serpin A4 Protein, Human (HEK293, His) is the recombinant human-derived Serpin A4 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Serpin A4 Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Serpin A4 Protein inhibits tissue kallikrein's amidolytic and kininogenase activities by forming a heat- and SDS-stable equimolar complex with the enzyme. Tissue kallikrein concurrently cleaves the reactive site of Serpin A4, producing a small C-terminal fragment. The protein, existing as a monomer and occasionally forming homodimers, demonstrates its regulatory role in modulating tissue kallikrein-mediated enzymatic activities. Serpin A4 Protein, Human (HEK293, His) is the recombinant human-derived Serpin A4 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Serpin A4 Protein functions as an inhibitor, specifically targeting the amidolytic and kininogenase activities of tissue kallikrein. This inhibitory mechanism involves the formation of an equimolar complex between the inhibitor and the enzyme, which is heat- and SDS-stable. Concurrently, tissue kallikrein cleaves the reactive site of Serpin A4, generating a small C-terminal fragment. The protein exists as a monomer and, in some instances, forms homodimers, showcasing its regulatory role in modulating tissue kallikrein-mediated enzymatic activities.

Biological Activity

Measured by its ability to inhibit KLK1 (HY-P73262) cleavage of a colorimetric peptide substrate, Pro-Phe-Arg-7-amido-4-methylcoumarin(HY-P2618) that incubate at 37°C for 60 minutes. The IC50 value is <10 nM.

Assay Procedure

Materials
Activation buffer: 50 mM Tris, 10 mM CaCl2, 150 mM NaCl, pH 7.5 (TCN)
Inhibition buffer: 25 mM Tris, 150 mM NaCl, pH 7.5
Assay buffer: 50 mM CHES, 250 mM NaCl, pH 10.0
Kallikrein-1 Protein, Human (240a.a, HEK293, His) (HY-P73262)
Bacterial Thermolysin
1,10-Phenanthroline
Serpin A4 Protein, Human (HEK293, His) (HY-P71143)
Substrate: Pro-Phe-Arg-7-amido-4-methylcoumarin (PFR-AMC, HY-137784)

Procedure
1. Dilute Human KLK1 to 100 μg/mL in activation buffer (containing 1 μg/mL Bacterial Thermolysin) .
2. Incubate at 37°C for 1 hour.
3. Add 1,10-Phenanthroline to a final concentration of 10 mM to stop the activation reaction.
4. Prepare different concentrations of Human Serpin A4 in assay buffer with the following serial dilutions: 8000, 4000, 2000, 1000, 625, 415, 200, 75 nM.
5. Dilute active Human KLK1 to 5 μg/mL in inhibition buffer.
6. Mix 20 μL of 5 μg/mL Human KLK1 with 20 μL of the Human Serpin A4 dilution series. Include two controls: 20 μL of inhibitor buffer and 20 μL of 5 μg/mL Human KLK1.
7. Incubate at 37°C for 1 hour.
8. Dilute the curve 62.5 times by adding assay buffer to each dilution.
9. Dilute the substrate to 200 μM in assay buffer.
10. Add 50 μL of the diluted mixture to the plate and initiate the reaction by adding 50 μL of 200 μM substrate to the wells. For the blank control group, add 50 μL of assay buffer and 50 μL of substrate.
11. Read in kinetic mode for 5 minutes at excitation wavelength 380 nm and emission wavelength 460 nm.
12. Determine the 50% inhibitory concentration (IC50) of Human Serpin A4 by plotting RFU/min versus concentration and fitting the data with a 4-parameter logistic (4-PL) curve.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P29622 (Q21-P427)

Gene ID
Molecular Construction
N-term
Serpin A4 (Q21-P427)
Accession # P29622
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Kallistatin; Kallikrein Inhibitor; Peptidase Inhibitor 4; PI-4; Serpin A4; SERPINA4; KST; PI4
AA Sequence

QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKP

Predicted Molecular Mass
47.2 kDa
Molecular Weight

Approximately 50-80&120-150 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Structure/Form
Monomer and some Non-covalent homodimers.
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 10 mM NaCl, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 6% Trehalose, 4% Mannitol, 50 mM NaCl, 0.05% Tween 80, pH 6.0.
3.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 50 mM NaCl, pH 6.0, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Serpin A4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Serpin A4 Protein, Human (HEK293, His)
Cat. No.:
HY-P71143
Quantity:
MCE Japan Authorized Agent: