1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Serpin (Protease Inhibitor)
  5. Serpin A10
  6. Serpin A10 Protein, Mouse (HEK293, His)

Serpin A10 Protein, an inhibitor, regulates by inhibiting the activity of coagulation protease factor Xa in the presence of PROZ, calcium, and phospholipids. It also shows inhibitory effects on factor XIa even without cofactors, highlighting its versatility in modulating key components of the coagulation cascade. Serpin A10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A10 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Serpin A10 Protein, an inhibitor, regulates by inhibiting the activity of coagulation protease factor Xa in the presence of PROZ, calcium, and phospholipids. It also shows inhibitory effects on factor XIa even without cofactors, highlighting its versatility in modulating key components of the coagulation cascade. Serpin A10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A10 protein, expressed by HEK293 , with C-His labeled tag.

Background

Serpin A10, functioning as an inhibitor, exerts its regulatory role by inhibiting the activity of the coagulation protease factor Xa in the presence of PROZ, calcium, and phospholipids. Additionally, it demonstrates inhibitory effects on factor XIa even in the absence of cofactors, showcasing its versatility in modulating key components of the coagulation cascade.

Biological Activity

Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2. The IC50 value is 27.513 nM, as measured under the described conditions.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q8R121-1 (F22-L448)

Gene ID
Molecular Construction
N-term
Serpin A10 (F22-L448)
Accession # Q8R121
His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Protein Z-Dependent Protease Inhibitor; PZ-Fependent Protease Inhibitor; PZI; Serpin A10; SERPINA10; ZPI
AA Sequence

FNLSSHSPEASVHLESQDYENQTWEEYTRTDPREEEEEEEEKEEGKDEEYWLRASQQLSNETSSFGFNLLRKISMRHDGNVIFSPFGLSVAMVNLMLGTKGETKVQIENGLNLQALSQAGPLILPALFKKVKETFSSNRDLGLSQGSFAFIHKDFDIKETYFNLSKKYFDIEYVSINFQNSSQARGLINHCIVKETEGKIPKLFDEINPETKLILVDYVLFKGKWLTPFDPSFTEADTFHLDKYRAIKVPMMYREGNFTSTFDKKFRCHILKLPYQGNATMLVVLMEKTGDYLALEDYLTVDLVETWLQNMKTRKMEVFFPKFKLNQRYEMHELLKQMGIRRLFSTSADLSELSAMARNLQVSRVLQQSVLEVDERGTEAVSGTLSEIIAYSMPPAIKVNRPFHFIIYEEMSRMLLFLGRVVNPTVL

Molecular Weight

Approximately 75-95 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Serpin A10 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Serpin A10 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76639
Quantity:
MCE Japan Authorized Agent: