1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Serpin (Protease Inhibitor)
  5. Serpin A10
  6. Serpin A10 Protein, Human (HEK293, His)

Serpin A10 protein inhibits coagulation proteases, such as factor Xa, in the presence of PROZ, calcium, and phospholipids. It can also inhibit factor XIa without cofactors. Serpin A10 interacts with PROZ to exert its inhibitory effects on these coagulation factors. Serpin A10 Protein, Human (HEK293, His) is the recombinant human-derived Serpin A10 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Serpin A10 protein inhibits coagulation proteases, such as factor Xa, in the presence of PROZ, calcium, and phospholipids. It can also inhibit factor XIa without cofactors. Serpin A10 interacts with PROZ to exert its inhibitory effects on these coagulation factors. Serpin A10 Protein, Human (HEK293, His) is the recombinant human-derived Serpin A10 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Serpin A10 protein functions as an inhibitor of coagulation proteases, specifically factor Xa, in the presence of PROZ, calcium, and phospholipids. Moreover, it can inhibit factor XIa even in the absence of cofactors. The protein interacts with PROZ to exert its inhibitory effects on these coagulation factors.

Biological Activity

Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide 20 μM substrate Mca-RPKPVE-Nval-WRK(Dnp)-NH2(HY-P2185A) that incubate at room temperature for 30 minutes. The IC50 value is 182.51 nM.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9UK55 (L22-L444)

Gene ID
Molecular Construction
N-term
Serpin A10 (L22-L444)
Accession # Q9UK55
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Protein Z-Dependent Protease Inhibitor; PZ-Fependent Protease Inhibitor; PZI; Serpin A10; SERPINA10; ZPI
AA Sequence

LAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLL

Molecular Weight

55-80 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 1 mM GaCl2, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Serpin A10 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Serpin A10 Protein, Human (HEK293, His)
Cat. No.:
HY-P71292
Quantity:
MCE Japan Authorized Agent: