Serglycin/SRGN Protein, Human (HEK293, His)

Serglycin/SRGN Protein, Human (HEK293, His) is the recombinant human-derived Serglycin/SRGN, expressed by HEK293 , with C-10*His labeled tag. ,

Serglycin (SRGN) serves as a crucial player in the formation of mast cell secretory granules, facilitating the storage of various compounds within secretory vesicles. Its indispensability is underscored by its role in storing proteases in connective tissue and mucosal mast cells, including the storage of granzyme B in T-lymphocytes. SRGN also contributes to the localization of neutrophil elastase in azurophil granules of neutrophils. Furthermore, it participates in the processing of MMP2 and, notably, plays a key role in granule-mediated apoptosis by forming a complex with granzyme B. This complex is delivered to cells by perforin, inducing apoptosis. Beyond its involvement in cytotoxic cell granule-mediated processes, SRGN regulates the secretion of TNF-alpha and potentially influences protease secretion. Intriguingly, SRGN exhibits inhibitory effects on bone mineralization and engages in binding interactions with activated CD44 and granzyme B (GZMB), highlighting its multifaceted roles in cellular processes and immune regulation.

Measured in a cell proliferation assay using M-NFS-60 cells. The ED₅₀ for this effect is 5.616 ng/mL, corresponding to a specific activity is 1.78×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using M-NFS-60 cells. The ED₅₀ for this effect is 5.616 ng/mL, corresponding to a specific activity is 1.78×10⁵ units/mg.

Human

HEK293

C-10*His

CAA34900.1/AAA60179.1 (Y28-L158)

5552  [NCBI]

Partial

YPTQRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML

Approximately 23 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.