1. Recombinant Proteins
  2. Others
  3. SECTM1A Protein, Mouse (HEK293, His)

SECTM1A Protein is a protein that encoded by SECTM1A gene. SECTM1A can bind to GITR on the surface of macrophages and activate the PI3K–Akt pathway, thereby enhancing the phagocytosis and bactericidal ability of macrophages SECTM1A can inhibit NF-κB signaling by activating the LXRα pathway, therby suppressing the inflammatory response. SECTM1A can positively regulate local proliferation of TRMs in the context of acute inflammation. SECTM1A Protein, Mouse (HEK293, His) is the recombinant mouse-derived SECTM1A protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SECTM1A Protein is a protein that encoded by SECTM1A gene. SECTM1A can bind to GITR on the surface of macrophages and activate the PI3K–Akt pathway, thereby enhancing the phagocytosis and bactericidal ability of macrophages SECTM1A can inhibit NF-κB signaling by activating the LXRα pathway, therby suppressing the inflammatory response. SECTM1A can positively regulate local proliferation of TRMs in the context of acute inflammation. SECTM1A Protein, Mouse (HEK293, His) is the recombinant mouse-derived SECTM1A protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Secreted and transmembrane 1A (SECTM1A) is a protein that encoded by SECTM1A gene. SECTM1A can bind to GITR on the surface of macrophages and activate the PI3K–Akt pathway, thereby enhancing the phagocytosis and bactericidal ability of macrophages and improving survival outcomes of septic mice. SECTM1A, as an alternative CD7 ligand, is also able to act as a T cells costimulator to enhance T cell proliferation and IL-2 production, but this effect is dependent on glucocorticoid-induced TNFR (GITR) activation. SECTM1A, as a new GITR ligand, promotes the expansion of Th cells, especially Th2, and increases secretion of Th2 cytokines, thereby stimulating the local proliferation of TRM and improve the survival rate of animals after LPS injection. SECTM1A can inhibit NF-κB signaling by activating the LXRα pathway, therby suppressing the inflammatory response. SECTM1A can be used for research on inflammatory diseases[1][2][3].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

A2ABP9 (Q28­T165)

Gene ID

209588  [NCBI]

Molecular Construction
N-term
SECTM1A (Q28-T165)
Accession # A2ABP9
6*His
C-term
Protein Length

Partial

Synonyms
SECTM1A; Sectm1a
AA Sequence

QNKSWDNPICTEGILSVPRGNPAVMTCNISNTFTDVTIQLSANGKDKTIFDKKPQGNFSWRGWELQVQGGLAQLVIKDTQDDHTGIYLWQLHGRQRCYKNITLNILEPSNEDKVPDTTLFTSFPDHAKSSPIEGKPGT

Molecular Weight

20-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SECTM1A Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SECTM1A Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70963
Quantity:
MCE Japan Authorized Agent: