1. Recombinant Proteins
  2. Others
  3. SCGB3A2 Protein, Mouse (His, GST)

SCGB3A2 is a secreted cytokine-like protein that interacts with pathogens (Listeria monocytogenes, Pseudomonas aeruginosa, yeast) and binds to the scavenger receptor MARCO. It strongly inhibits PLA2G1B activity and regulates lipid metabolism. SCGB3A2 Protein, Mouse (His, GST) is the recombinant mouse-derived SCGB3A2 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SCGB3A2 is a secreted cytokine-like protein that interacts with pathogens (Listeria monocytogenes, Pseudomonas aeruginosa, yeast) and binds to the scavenger receptor MARCO. It strongly inhibits PLA2G1B activity and regulates lipid metabolism. SCGB3A2 Protein, Mouse (His, GST) is the recombinant mouse-derived SCGB3A2 protein, expressed by E. coli , with N-GST, N-6*His labeled tag.

Background

SCGB3A2 is a secreted cytokine-like protein that exhibits diverse functions, including binding to the scavenger receptor MARCO and interacting with various pathogens such as the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast. Notably, it strongly inhibits phospholipase A2 (PLA2G1B) activity, showcasing its regulatory role in lipid metabolism. SCGB3A2 demonstrates anti-inflammatory effects in respiratory epithelium and exerts anti-fibrotic activity in the lung. It may contribute to fetal lung development and maturation, promoting branching morphogenesis during early stages of lung development. Additionally, in the pituitary, SCGB3A2 is implicated in inhibiting the production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH). The protein exists as a homodimer, linked by disulfide bonds, and can also function as a monomer. Furthermore, SCGB3A2 interacts with APOA1, emphasizing its involvement in diverse physiological processes.

Biological Activity

Measured in a cytotoxicity assay using A549 cells in the presence of 0.5 μg/mL LPS (HY-D1056). The ED50 of this effect is <1 μg/mL.

Species

Mouse

Source

E. coli

Tag

N-GST;N-6*His

Accession

Q920H1-1 (L22-L139)

Gene ID
Protein Length

Partial

Synonyms
Scgb3a2; Pnsp1; Ugrp1; Secretoglobin family 3A member 2; Pneumo secretory protein 1; PnSP-1; Uteroglobin-related protein 1
AA Sequence

LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL

Molecular Weight

Approximately 43 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, pH 7.4, 6% or 8% Trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SCGB3A2 Protein, Mouse (His, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SCGB3A2 Protein, Mouse (His, GST)
Cat. No.:
HY-P71605
Quantity:
MCE Japan Authorized Agent: