1. Recombinant Proteins
  2. Others
  3. Uteroglobin/SCGB1A1 Protein, Mouse (HEK293, His)

Uteroglobin/SCGB1A1 Protein, Mouse (HEK293, His)

Cat. No.: HY-P71419
Handling Instructions Technical Support

Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Uteroglobin/SCGB1A1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Uteroglobin/SCGB1A1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Uteroglobin/SCGB1A1 Protein exhibits versatile binding capabilities, interacting with phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB), and displaying weak binding to progesterone. Additionally, it acts as a potent inhibitor of phospholipase A2. Structurally, Uteroglobin forms an antiparallel homodimer, held together by disulfide linkages. However, the reported interaction with LMBR1L remains controversial, emphasizing the need for further investigation into this specific molecular association. The multifaceted binding properties of Uteroglobin underscore its potential role in diverse cellular processes, including lipid metabolism and inflammatory responses.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q06318 (D22-F96)

Gene ID
Molecular Construction
N-term
SCGB1A1 (D22-F96)
Accession # Q06318
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Uteroglobin; Clara cell 17 kDa protein; Clara cell phospholipid-binding protein; CCPBP; Clara cells 10 kDa secretory protein; CC10; PCB-binding protein; Secretoglobin family 1A member 1; Scgb1a1; Cc10; Ugb; Utg
AA Sequence

DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Molecular Weight

Approximately 9.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Uteroglobin/SCGB1A1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Uteroglobin/SCGB1A1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71419
Quantity:
MCE Japan Authorized Agent: