1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. SCF Protein, Canine

SCF protein critically promotes mast cell proliferation, enhancing both myeloid and lymphoid hematopoietic progenitor proliferation in bone marrow. Additionally, SCF facilitates cell-cell adhesion and synergizes with other cytokines, potentially interleukins. As a homodimer, SCF is connected non-covalently, contributing to hematopoietic processes and immune responses. SCF Protein, Canine is the recombinant canine-derived SCF protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SCF protein critically promotes mast cell proliferation, enhancing both myeloid and lymphoid hematopoietic progenitor proliferation in bone marrow. Additionally, SCF facilitates cell-cell adhesion and synergizes with other cytokines, potentially interleukins. As a homodimer, SCF is connected non-covalently, contributing to hematopoietic processes and immune responses. SCF Protein, Canine is the recombinant canine-derived SCF protein, expressed by E. coli , with tag free.

Background

The SCF Protein plays a critical role in promoting the proliferation of mast cells. It has the capacity to enhance the proliferation of both myeloid and lymphoid hematopoietic progenitors when cultured in the bone marrow. Additionally, SCF facilitates cell-cell adhesion. It acts synergistically with other cytokines, likely including interleukins. SCF exists as a homodimer, connected via non-covalent interactions.

Biological Activity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1.679 ng/mL.

  • Measured in a cell proliferation assay using TF 1 human erythroleukemic cells. The ED50 for this effect is 1.679 ng/mL, corresponding to a specific activity is 5.96×105 units/mg.
Species

Canine

Source

E. coli

Tag

Tag Free

Accession

Q06220 (K26-A190)

Gene ID
Molecular Construction
N-term
SCF (K26-A190)
Accession # Q06220
C-term
Protein Length

Partial

Synonyms
Kit ligand; Mast cell growth factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG
AA Sequence

KGICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVA

Molecular Weight

Approximately 19 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SCF Protein, Canine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SCF Protein, Canine
Cat. No.:
HY-P79111
Quantity:
MCE Japan Authorized Agent: