1. Recombinant Proteins
  2. Others
  3. SBDS Protein, Mouse (His)

SBDS proteins are essential for the assembly of mature ribosomes and ribosome biogenesis. It cooperates with EFL1 to catalyze the GTP-dependent release of EIF6 from 60S preribosomes in the cytoplasm, activating the translation ability of ribosomes. SBDS Protein, Mouse (His) is the recombinant mouse-derived SBDS protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SBDS proteins are essential for the assembly of mature ribosomes and ribosome biogenesis. It cooperates with EFL1 to catalyze the GTP-dependent release of EIF6 from 60S preribosomes in the cytoplasm, activating the translation ability of ribosomes. SBDS Protein, Mouse (His) is the recombinant mouse-derived SBDS protein, expressed by E. coli , with N-His labeled tag.

Background

SBDS is an indispensable factor in the assembly of mature ribosomes and the intricate process of ribosome biogenesis. Collaborating with EFL1, it orchestrates the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence. This function involves facilitating the assembly of 80S ribosomes and ensuring EIF6 recycling to the nucleus, where it is vital for 60S rRNA processing and nuclear export. SBDS is crucial for maintaining normal levels of protein synthesis and may contribute to cellular stress resistance, DNA damage response, and cell proliferation. The protein forms associations with the 60S ribosomal subunit and interacts with key partners such as NPM1, RPA1, and PRKDC. It is also part of a complex comprising the 60S ribosomal subunit, SBDS, and EFL1. Furthermore, SBDS may engage in interactions with NIP7 and CLN3, underscoring its multifaceted role in cellular processes.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P70122 (M1-E250)

Gene ID
Molecular Construction
N-term
His
SBDS (M1-E250)
Accession # P70122
C-term
Synonyms
Ribosome maturation protein SBDS; SBDS; CGI-97
AA Sequence

MSIFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLMKVVESEDYSQQLEIVCLIDPGCFREIDELIKKETKGRGSLEVLSLKDVEEGDEKFE

Molecular Weight

Approximately 30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SBDS Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SBDS Protein, Mouse (His)
Cat. No.:
HY-P76049
Quantity:
MCE Japan Authorized Agent: