1. Recombinant Proteins
  2. Viral Proteins
  3. SARS-CoV-2 Proteins
  4. SARS-CoV-2 Non-structural Proteins
  5. SARS-CoV-2 NSP7 SARS-CoV-2 NSP8
  6. SARS-CoV-2 NSP8 Protein (His)

The ORF1ab gene is a specifically expressed gene of SARS-CoV-2 and can be quickly and sensitively detected to indirectly indicate the level of SARS-CoV-2. The ORF1ab protein is associated with viral replication and transcription, inhibition of host translation machinery, and suppression of host immune responses. SARS-CoV-2 NSP8 Protein (His) is the recombinant Virus-derived SARS-CoV-2 NSP8 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ORF1ab gene is a specifically expressed gene of SARS-CoV-2 and can be quickly and sensitively detected to indirectly indicate the level of SARS-CoV-2. The ORF1ab protein is associated with viral replication and transcription, inhibition of host translation machinery, and suppression of host immune responses. SARS-CoV-2 NSP8 Protein (His) is the recombinant Virus-derived SARS-CoV-2 NSP8 protein, expressed by E. coli , with C-6*His labeled tag.

Background

The ORF1ab gene is a specifically expressed gene of SARS-CoV-2 and can be quickly and sensitively detected to indirectly indicate the level of SARS-CoV-2. In the evolutionary dynamics of the novel COVID-19 pandemic, SARS-CoV-2 early evolved into at least three phylogenetic groups characterized by positive selection of specific residues of the accessory proteins ORF3a and ORF8. The five known human betacoronaviruses all have four major structural proteins (E, M, N, and S) and 16 nonstructural proteins (ORF1ab) co-encoded by ORF1a and ORF1b, which are involved in the pathogenicity of the virus. and infectivity. Three of these genes (E, S, and ORF1ab genes) are characterized by strong positive selection in human betacoronaviruses, affecting codons located in functionally important protein domains. ORF1ab protein plays an important role in inhibiting host translation machinery, viral replication and transcription, and suppressing host immune responses. An electrochemiluminescence (ECL) biosensor based on dual-probe hybridization has been developed, using the detection model of "magnetic capture probe-targeted nucleic acid-Ru(bpy)32+ labeled signal probe" to detect the ORF1ab target gene. detection.

Species

Virus

Source

E. coli

Tag

C-6*His

Accession

YP_009725304.1 (A1-Q198)

Gene ID

43740578  [NCBI]

Molecular Construction
N-term
SARS-CoV-2 NSP8 (A1-Q198)
Accession # YP_009725304.1
6*His
C-term
Synonyms
r2019-nCoV NSP8, His; SARS-CoV 2 nsp8
AA Sequence

AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ

Molecular Weight

Approximately 23.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.5.

Endotoxin Level

NA

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SARS-CoV-2 NSP8 Protein (His)
Cat. No.:
HY-P70130
Quantity:
MCE Japan Authorized Agent: