1. Recombinant Proteins
  2. Others
  3. S100A9 Protein, Human

S100A9 Protein is an acidic protein. S100A9 Protein activates pro-inflammatory signaling pathways by binding to TLR4/MD2 and RAGE receptors, regulating transcription factors such as NF-κB, CREB-1, STAT3/STAT5, etc. S100A9 Protein forms a heterodimer (calprotectin) with S100A8. S100A9 Protein enhances cytokine secretion under inflammatory stimulation, promotes immune cell migration, regulates vascular endothelial permeability, induces tumor cell apoptosis, and exerts antibacterial effects through metal ion chelation.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg Get quote
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE S100A9 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

S100A9 Protein is an acidic protein. S100A9 Protein activates pro-inflammatory signaling pathways by binding to TLR4/MD2 and RAGE receptors, regulating transcription factors such as NF-κB, CREB-1, STAT3/STAT5, etc. S100A9 Protein forms a heterodimer (calprotectin) with S100A8. S100A9 Protein enhances cytokine secretion under inflammatory stimulation, promotes immune cell migration, regulates vascular endothelial permeability, induces tumor cell apoptosis, and exerts antibacterial effects through metal ion chelation.

Background

S100A9 protein belongs to the S100 calcium-binding protein family. The members of this family contain EF-hand domains and have calcium-dependent regulatory functions[3][7]. S100A9 protein is an acidic protein expressed by myeloid cells such as monocytes and neutrophils. It often forms a heterodimer with S100A8 (calprotectin) and participates in inflammation, immunity and host defense processes[1][2][5]. S100A9 Protein activates pro-inflammatory signaling pathways by binding to TLR4/MD2 and RAGE receptors, regulates transcription factors such as NF-κB, CREB-1, STAT3/STAT5, and affects the secretion of cytokines (such as IL-8); regulates cytoskeleton reorganization by interacting with tubulin, and promotes transendothelial migration of phagocytes; and can also exert antibacterial activity or induce tumor cell apoptosis by chelating zinc ions[1][4][5][6][7]. S100A9 Protein is mainly expressed in the cytoplasm of neutrophils and monocytes. It can be secreted outside the cells under inflammatory conditions and enriched on the surface of endothelial cells and in body fluids at the site of inflammation[1][5][7]. S100A9 Protein, Human is highly conserved in amino acid sequence and function with its homologous proteins in other species such as mice. Both proteins mediate biological effects through calcium/zinc ion-dependent conformational changes, but some regulatory sites (such as the lack of Thr113 phosphorylation site in mouse S100A9) differ[4][7]. S100A9 Protein, Human consists of 119 amino acids with a molecular weight of approximately 14 kDa. It contains two EF-hand calcium-binding domains and can form homodimers or heterodimers with S100A8. Its activity depends on the cooperative binding of calcium/zinc ions and phosphorylation modification by kinases such as p38 MAPK[1][4][7]. S100A9 Protein, Human Enhances cytokine secretion under inflammatory stimulation, promotes immune cell migration, regulates vascular endothelial permeability, induces tumor cell apoptosis, and exerts antibacterial effects through metal ion chelation[1][5][6][7].

In Vitro

S100A9 Protein, Human (10 μg/mL; 30 min) can enhance fMLP- or GM-CSF-stimulated IL-8 production by activating transcription factors such as NF-κB and CREB-1[1].
S100A9 Protein, Human (1.25-10 μM; 1-4 d) induces apoptosis in MM46 mouse breast cancer cells[6].

Biological Activity

Measured by its ability to induce CXCL1/KC secretion by C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 1.616 - 3.731 μg/mL.

  • Measured by its ability to enhance CXCL1secretion by C3H/10T1/2 Mouse embryonic fibroblasts. The ED50 for this effect is 3.295 μg/mL, corresponding to a specific activity is 303.4901 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P06702 (T2-P114)

Gene ID
Molecular Construction
N-term
S100A9 (T2-P114)
Accession # P06702
C-term
Protein Length

Partial

Synonyms
Protein S100-A9; Calgranulin-B; Calprotectin L1H subunit; Leukocyte L1 complex heavy chain; MRP-14; CAGB; CFAG
AA Sequence

TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Molecular Weight

Approximately 14.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or 50 mM Tris-HCl, 300 mM NaCL, pH 8.0 or PBS, pH 7.4, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

S100A9 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A9 Protein, Human
Cat. No.:
HY-P70532
Quantity:
MCE Japan Authorized Agent: