1. Recombinant Proteins
  2. Others
  3. S100A8-S100A9 Heterodimer Protein, Human (His, solution)

S100A8-S100A9 Heterodimer Protein, Human (His, solution)

Cat. No.: HY-P71076
Handling Instructions Technical Support

S100A8 consists of calcium and zinc bound S100A8, which plays a critical regulatory role in inflammation and immune responses. As calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. S100A8-S100A9 Heterodimer Protein, Human (His, solution) is a recombinant protein dimer complex containing human-derived S100A8-S100A9 Heterodimer protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg Get quote
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE S100A8-S100A9 Heterodimer Protein, Human (His, solution)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100A8 consists of calcium and zinc bound S100A8, which plays a critical regulatory role in inflammation and immune responses. As calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. S100A8-S100A9 Heterodimer Protein, Human (His, solution) is a recombinant protein dimer complex containing human-derived S100A8-S100A9 Heterodimer protein, expressed by E. coli , with C-6*His labeled tag.

Background

The S100A8, consisting of calcium- and zinc-binding S100A8, plays a crucial role in regulating inflammatory processes and immune responses. Often found as calprotectin (S100A8/A9), it serves diverse intracellular functions, including facilitating leukocyte arachidonic acid trafficking and metabolism, modulating the tubulin-dependent cytoskeleton during phagocyte migration, and activating the neutrophilic NADPH-oxidase. In particular, it activates NADPH-oxidase by aiding in the assembly of the enzyme complex at the cell membrane, transferring arachidonic acid, and directly binding to NCF2/P67PHOX. Extracellularly, it exhibits pro-inflammatory, antimicrobial, oxidant-scavenging, and apoptosis-inducing activities. Acting as an alarmin or danger-associated molecular pattern (DAMP) molecule, S100A8 stimulates innate immune cells through binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER), activating MAP-kinase and NF-kappa-B signaling pathways and amplifying the pro-inflammatory cascade. With antimicrobial activity against bacteria and fungi, it likely exerts this effect through Zn(2+) chelation essential for microbial growth. Additionally, S100A8/A9 induces cell death via autophagy and apoptosis, regulates neutrophil number and apoptosis, and acts as an oxidant scavenger to prevent tissue damage. Its role as an amplifier of inflammation in autoimmunity and cancer development is notable, and in microbial infection, such as by SARS-CoV-2, it may induce expansion of aberrant immature neutrophils in a TLR4-dependent manner.

Biological Activity

1.Measured by its ability to induce IL-6 secretion by A375 human melanoma cells. The ED50 for this effect is 1.544 μg/mL.
2.Immobilized Recombinant Human S100A8/A9 Heterodimer (C 6His) at 2 μg/mL (100 μl/well) can bind Anti-Human S100A9 Antibody. The ED50 of Anti-Human S100A9 Antibody is 9.91 ng/mL.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P05109 (M1-E93) (S100A8)&P06702 (T2-P114) (S100A9)

Gene ID

6279  [NCBI]&6280  [NCBI]

Molecular Construction
N-term
S100A8 (M1-E93)
Accession # P05109
6*His
C-term
N-term
S100A9 (T2-P114)
Accession # P06702
6*His
C-term
Synonyms
S100A8/S100A9 Heterodimer
AA Sequence

A1:
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
A2:
TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Molecular Weight

13&15 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 20 mM HEPES, 10% Glycerol, 150 mM NaCl, 2.5 mM EDTA, pH 7.4.
2.Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 300 mM NaCl, 200 mM Arginine, pH 7.5.
3.Supplied as a 0.22 μm filtered solution of PBS, 2 mM DTT, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: If this product is used in SPR assay, please note that the protein buffer should not contain primary amino components (such as Tris and Imidazole), and the buffer needs to be replaced.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

S100A8-S100A9 Heterodimer Protein, Human (His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A8-S100A9 Heterodimer Protein, Human (His, solution)
Cat. No.:
HY-P71076
Quantity:
MCE Japan Authorized Agent: