1. Recombinant Proteins
  2. Others
  3. S100A7A Protein, Human (P.pastoris, His)

The S100A7A protein plays potential roles in skin homeostasis, epidermal differentiation, and inflammation, suggesting its importance in skin health and disease. Its involvement in cellular functions makes it a key factor in diseases such as psoriasis, which is characterized by abnormal epidermal processes and inflammation. S100A7A Protein, Human (P.pastoris, His) is the recombinant human-derived S100A7A protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100A7A protein plays potential roles in skin homeostasis, epidermal differentiation, and inflammation, suggesting its importance in skin health and disease. Its involvement in cellular functions makes it a key factor in diseases such as psoriasis, which is characterized by abnormal epidermal processes and inflammation. S100A7A Protein, Human (P.pastoris, His) is the recombinant human-derived S100A7A protein, expressed by P. pastoris , with N-His labeled tag.

Background

S100A7A Protein emerges as a potential player in epidermal differentiation and inflammation, suggesting a pivotal role in the intricate processes that contribute to skin homeostasis and immune response. Its implication in these cellular functions positions S100A7A as a potentially significant factor in the pathogenesis of diseases such as psoriasis, where aberrant epidermal differentiation and inflammation play key roles. The dual involvement in epidermal processes and inflammatory responses underscores the potential multifaceted impact of S100A7A on skin health and disease. Further exploration of its specific mechanisms and interactions may deepen our understanding of S100A7A's role in skin physiology and its potential implications in various pathological contexts, particularly those related to skin disorders and inflammatory conditions.

Species

Human

Source

P. pastoris

Tag

N-His

Accession

Q86SG5 (S2-Q101)

Gene ID
Molecular Construction
N-term
His
S100A7A (S2-Q101)
Accession # Q86SG5
C-term
Protein Length

Partial

Synonyms
S100A7A; S100A15; S100A7L1; S100 calcium-binding protein A7A
AA Sequence

SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ

Predicted Molecular Mass
13.2 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

S100A7A Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A7A Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71837
Quantity:
MCE Japan Authorized Agent: