1. Recombinant Proteins
  2. Others
  3. S100A7 Protein, Human

The S100A7 protein is known to interact with RANBP9, suggesting a potential functional relationship between the two molecules. However, no details of their interaction are provided in the referenced paragraph. S100A7 Protein, Human is the recombinant human-derived S100A7 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100A7 protein is known to interact with RANBP9, suggesting a potential functional relationship between the two molecules. However, no details of their interaction are provided in the referenced paragraph. S100A7 Protein, Human is the recombinant human-derived S100A7 protein, expressed by E. coli , with tag free.

Background

S100A7 protein is known to interact with RANBP9, indicating a potential functional relationship between these two molecules. S100A7 belongs to the S100 family of calcium-binding proteins and has been implicated in various biological processes, including inflammation and cancer. The interaction with RANBP9 suggests a potential role for S100A7 in cellular signaling or protein transport, but further investigation is required to fully understand the functional implications of this interaction.

Biological Activity

Measured by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells. The ED50 for this effect is 2.355 μg/mL, corresponding to a specific activity is 424.628 U/mg.

  • Measured by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells. The ED50 for this effect is 2.355 μg/mL, corresponding to a specific activity is 424.628 U/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P31151 (M1-Q101)

Gene ID
Molecular Construction
N-term
S100A7 (M1-Q101)
Accession # P31151
C-term
Protein Length

Full Length

Synonyms
Protein S100-A7; Psoriasin; S100 calcium-binding protein A7; S100A7; PSOR1; S100A7C
AA Sequence

MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

Molecular Weight

Approximately 14.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM Tris-HCL, 150 mM NaCl, 2 mM CaCl2, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

S100A7 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A7 Protein, Human
Cat. No.:
HY-P71274
Quantity:
MCE Japan Authorized Agent: