1. Recombinant Proteins
  2. Others
  3. S100A6 Protein, Mouse

The S100A6 protein binds calcium and zinc ions and acts as a multifunctional regulator. Its presence in the extracellular matrix suggests its involvement in extracellular processes. S100A6 Protein, Mouse is the recombinant mouse-derived S100A6 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100A6 protein binds calcium and zinc ions and acts as a multifunctional regulator. Its presence in the extracellular matrix suggests its involvement in extracellular processes. S100A6 Protein, Mouse is the recombinant mouse-derived S100A6 protein, expressed by E. coli , with tag free.

Background

S100A6 protein exhibits calcium ion binding activity and zinc ion binding activity, underscoring its role as a multifunctional regulator. This protein is localized in the collagen-containing extracellular matrix, signifying its involvement in extracellular processes. Its expression is observed in various structures, including the eye, genitourinary system, gut, hemolymphoid system gland, and trophectoderm, indicating its potential roles in diverse physiological functions. The orthologous relationship to human S100A6 emphasizes the evolutionary conservation of this protein across species. Moreover, its biased expression in specific tissues, such as the bladder and colon, highlights its potential significance in the context of tissue-specific functions and regulation.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

NP_035443.1 (M1-K89)

Gene ID
Molecular Construction
N-term
S100A6 (M1-K89)
Accession # NP_035443.1
C-term
Protein Length

Full Length

Synonyms
Protein S100-A6; Calcyclin; MLN 4; PRA; S100 calcium-binding protein A6; CACY
AA Sequence

MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK

Molecular Weight

Approximately 10 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

S100A6 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A6 Protein, Mouse
Cat. No.:
HY-P74584
Quantity:
MCE Japan Authorized Agent: