1. Recombinant Proteins
  2. Others
  3. S100A3 Protein, Mouse (His)

S100A3 Protein, acting as a homodimer with disulfide linkages, exhibits strong binding affinity for beta-galactoside and lactose.Notably, it potently induces T-cell apoptosis, as demonstrated in various studies, and displays hemagglutinating activity towards chicken erythrocytes.These properties underscore S100A3's multifaceted roles in cellular interactions and immune modulation.S100A3 Protein, Mouse (His) is the recombinant mouse-derived S100A3 protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100A3 Protein, acting as a homodimer with disulfide linkages, exhibits strong binding affinity for beta-galactoside and lactose.Notably, it potently induces T-cell apoptosis, as demonstrated in various studies, and displays hemagglutinating activity towards chicken erythrocytes.These properties underscore S100A3's multifaceted roles in cellular interactions and immune modulation.S100A3 Protein, Mouse (His) is the recombinant mouse-derived S100A3 protein, expressed by E.coli , with N-His labeled tag.

Background

Galectin-13, acting as a homodimer through disulfide linkages, demonstrates binding affinity for beta-galactoside and lactose. Additionally, it serves as a potent inducer of T-cell apoptosis, as evidenced by various studies. Moreover, Galectin-13 exhibits hemagglutinating activity specifically towards chicken erythrocytes. These properties highlight its multifaceted roles in cellular interactions and immune modulation.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P62818 (M1-Q101)

Gene ID
Molecular Construction
N-term
His
S100A3 (M1-Q101)
Accession # P62818
C-term
Protein Length

Full Length

Synonyms
Protein S100-A3; Protein S-100E; S100 calcium-binding protein A3
AA Sequence

MTRPLEQAVAAIVCTFQEYAGRCGDKYKICQSELKELLQKELPTWTPSEFRECDYNKFMSVLDTNKDCEVDFGEYVRSLASLCLYCHEYFKECPPEPPCPQ

Molecular Weight

Approximately 12 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

S100A3 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A3 Protein, Mouse (His)
Cat. No.:
HY-P76017
Quantity:
MCE Japan Authorized Agent: