1. Recombinant Proteins
  2. Others
  3. S100A16 Protein, Human

S100A16 is a calcium-binding protein that binds one calcium ion per monomer. It is associated with the promotion of adipocyte differentiation in vitro, suggesting a potential regulatory role in cell development. S100A16 Protein, Human is the recombinant human-derived S100A16 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100A16 is a calcium-binding protein that binds one calcium ion per monomer. It is associated with the promotion of adipocyte differentiation in vitro, suggesting a potential regulatory role in cell development. S100A16 Protein, Human is the recombinant human-derived S100A16 protein, expressed by E. coli , with tag free.

Background

S100A16 is a calcium-binding protein known to bind one calcium ion per monomer. It has been implicated in various cellular processes, particularly in adipocyte differentiation. In vitro studies suggest that S100A16 can promote the differentiation of adipocytes. Notably, overexpression of S100A16 in preadipocytes has been associated with increased proliferation, enhanced adipogenesis, and a reduction in insulin-stimulated glucose uptake. The protein forms homodimers and has been shown to interact with TP53, suggesting a potential role in cellular signaling pathways. These findings underscore the multifaceted nature of S100A16, indicating its involvement in calcium-dependent processes and its impact on cellular differentiation and metabolic regulation.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q96FQ6 (M1-S103)

Gene ID
Molecular Construction
N-term
S100A16 (M1-S103)
Accession # Q96FQ6
C-term
Synonyms
Protein S100-A16; Aging-associated gene 13 protein; Protein S100-F; S100 calcium-binding protein A16; S100A16; S100F; AAG13
AA Sequence

MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS

Molecular Weight

Approximately 12.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.0 .

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

S100A16 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A16 Protein, Human
Cat. No.:
HY-P71273
Quantity:
MCE Japan Authorized Agent: