1. Recombinant Proteins
  2. Others
  3. S100A13 Protein, Mouse (N-His)

S100A13 Protein, acting as a homodimer, facilitates the export of signal peptide-lacking proteins through an alternative pathway, binding two calcium ions and one copper ion per subunit. It is crucial for the copper-dependent stress-induced export of IL1A and FGF1, with the calcium-free form binding to phosphatidylserine-containing lipid vesicles. S100A13 is part of a copper-dependent multiprotein complex, interacting with FGF1, SYT1, and IL1A. S100A13 Protein, Mouse (N-His) is the recombinant mouse-derived S100A13 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100A13 Protein, acting as a homodimer, facilitates the export of signal peptide-lacking proteins through an alternative pathway, binding two calcium ions and one copper ion per subunit. It is crucial for the copper-dependent stress-induced export of IL1A and FGF1, with the calcium-free form binding to phosphatidylserine-containing lipid vesicles. S100A13 is part of a copper-dependent multiprotein complex, interacting with FGF1, SYT1, and IL1A. S100A13 Protein, Mouse (N-His) is the recombinant mouse-derived S100A13 protein, expressed by E. coli , with N-His labeled tag.

Background

The S100A13 protein plays a crucial role in the export of proteins that lack a signal peptide and are secreted through an alternative pathway. It has the ability to bind two calcium ions per subunit and one copper ion, with the binding of the latter not interfering with calcium binding. S100A13 is essential for the copper-dependent stress-induced export of IL1A and FGF1. Interestingly, the calcium-free form of the protein can bind to lipid vesicles containing phosphatidylserine but not those containing phosphatidylcholine. S100A13 functions as a homodimer and is part of a copper-dependent multiprotein complex alongside FGF1 and SYT1. It also interacts with FGF1, SYT1, and IL1A.

Biological Activity

Measured by its ability to enhance the outgrowth of SH-SY5Y cells. The ED50 of this effect is 1.075 μg/mL, corresponding to a specific activity is 930.233 units/mg.

  • Measured by its ability to enhance the outgrowth of SH-SY5Y cells. The ED50 of this effect is 1.075 μg/mL, corresponding to a specific activity is 930.233 units/mg.
Species

Mouse

Source

E. coli

Tag

N-His

Accession

P97352 (M1-K98)

Gene ID

20196

Molecular Construction
N-term
His
S100A13 (M1-K98)
Accession # P97352
C-term
Synonyms
Protein S100-A13; S100A13; S100 calcium-binding protein A13
AA Sequence

MAAETLTELEAAIETVVSTFFTFAGREGRKGSLNINEFKELATQQLPHLLKDVGSLDEKMKTLDVNQDSELRFSEYWRLIGELAKEVRKEKALGIRKK

Molecular Weight

Approximately 12 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

S100A13 Protein, Mouse (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A13 Protein, Mouse (N-His)
Cat. No.:
HY-P76583A
Quantity:
MCE Japan Authorized Agent: