1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. RUVBL2 Protein, Human (His-SUMO)

The RUVBL2 protein has DNA-stimulated ATPase and DNA helicase activities and can hexamerize for ATP hydrolysis. As a member of the NuA4 complex, RUVBL2 contributes to histone acetylation, altering nucleosome-DNA interactions to activate genes. RUVBL2 Protein, Human (His-SUMO) is the recombinant human-derived RUVBL2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RUVBL2 protein has DNA-stimulated ATPase and DNA helicase activities and can hexamerize for ATP hydrolysis. As a member of the NuA4 complex, RUVBL2 contributes to histone acetylation, altering nucleosome-DNA interactions to activate genes. RUVBL2 Protein, Human (His-SUMO) is the recombinant human-derived RUVBL2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

RUVBL2 protein possesses single-stranded DNA-stimulated ATPase and ATP-dependent DNA helicase (5' to 3') activity, with hexamerization considered critical for ATP hydrolysis, and adjacent subunits in the ring-like structure contributing to the ATPase activity. As a component of the NuA4 histone acetyltransferase complex, RUVBL2 is involved in the transcriptional activation of select genes, primarily through the acetylation of nucleosomal histones H4 and H2A. This modification may alter nucleosome-DNA interactions and promote interaction of the modified histones with other proteins that positively regulate transcription. The NuA4 complex, including the ATPase and helicase activities, is, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Furthermore, RUVBL2 is a component of a SWR1-like complex responsible for the removal of histone H2A.Z/H2AZ1 from the nucleosome and is proposed as a core component of the chromatin remodeling INO80 complex, which exhibits DNA- and nucleosome-activated ATPase activity and catalyzes ATP-dependent nucleosome sliding. RUVBL2 plays an essential role in oncogenic transformation by MYC and also modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex. Additionally, it may inhibit the transcriptional activity of ATF2 and is involved in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway, negatively regulating expression of ER stress response genes. RUVBL2 may also play a role in regulating the composition of the U5 snRNP complex.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

Q9Y230-1 (A2-S463)

Gene ID
Molecular Construction
N-term
6*His-SUMO
RUVBL2 (A2-S463)
Accession # Q9Y230-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
48kDa TATA box-binding protein-interacting protein; CGI-46; TIH2; TIP48; TIP49b; TIP60-associated protein 54-beta; wu:fi25f01; zreptin
AA Sequence

ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

Molecular Weight

Approximately 67.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RUVBL2 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RUVBL2 Protein, Human (His-SUMO)
Cat. No.:
HY-P71661
Quantity:
MCE Japan Authorized Agent: