1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. RSPO1/R-spondin-1 Protein, Human (HEK293, His)

RSPO1/R-spondin-1 is a secreted glycoprotein. RSPO1/R-spondin-1 binds to LGR4/5/6 receptors and ZNRF3/E3 ubiquitin ligases, inhibits Wnt receptor degradation, stabilizes β-catenin and promotes its nuclear translocation, and activates target gene transcription. RSPO1/R-spondin-1, Human promotes intestinal organoid survival, induces pancreatic β-cell proliferation to improve diabetes, enhances osteogenic differentiation of mesenchymal stem cells to treat osteoporosis, and inhibits bone erosion in arthritis models. RSPO1/R-spondin-1 Protein, Human (HEK293, His) is a recombinant RSPO1/R-spondin-1 protein expressed by HEK293 with a C-His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE RSPO1/R-spondin-1 Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

RSPO1/R-spondin-1 is a secreted glycoprotein. RSPO1/R-spondin-1 binds to LGR4/5/6 receptors and ZNRF3/E3 ubiquitin ligases, inhibits Wnt receptor degradation, stabilizes β-catenin and promotes its nuclear translocation, and activates target gene transcription. RSPO1/R-spondin-1, Human promotes intestinal organoid survival, induces pancreatic β-cell proliferation to improve diabetes, enhances osteogenic differentiation of mesenchymal stem cells to treat osteoporosis, and inhibits bone erosion in arthritis models. RSPO1/R-spondin-1 Protein, Human (HEK293, His) is a recombinant RSPO1/R-spondin-1 protein expressed by HEK293 with a C-His tag.

Background

RSPO1/R-spondin-1 belongs to the R-spondin family (including 4 members, RSPO 1-4)[2][4]. RSPO1/R-spondin-1 is a secreted glycoprotein. RSPO1/R-spondin-1 binds to LGR4/5/6 receptors and ZNRF3/E3 ubiquitin ligase, inhibits Wnt receptor degradation, stabilizes β-catenin and promotes its nuclear translocation, and activates target gene transcription[2][4][7]. RSPO1/R-spondin-1 is expressed in intestinal epithelium, pancreatic acini, bone mesenchyme, joint osteoblasts and other tissues[1][5][6][7]. RSPO1/R-spondin-1, Human is highly homologous to RSPO1 in mouse, rat and other species in terms of amino acid sequence and function (such as activating Wnt signaling and promoting tissue regeneration)[5][6]. RSPO1/R-spondin-1, Human is composed of 263 amino acids, contains N-glycosylation modification (such as Asn137 site), and sugar chain structures include sialic acid, N-acetylglucosamine, etc.[4]. RSPO1/R-spondin-1, Human promotes the survival of intestinal organoids, induces pancreatic β-cell proliferation to improve diabetes, enhances the osteogenic differentiation of mesenchymal stem cells to treat osteoporosis, and inhibits bone erosion in arthritis models[2][5][6][7].

In Vitro

RSPO1/R-spondin-1, Human (500 ng/mL) increases size and survival in mouse intestinal organoid unit (OU) culture and activates the Wnt/β-catenin pathway[2].
RSPO1/R-spondin-1, Human (1 μg/mL) induces expansion of human pancreatic organoids (hPOs) and maintains a ductal cell phenotype[3].
RSPO1/R-spondin-1, Human (400 nM; 24 h) promotes proliferation of pancreatic β cells in MIN6 mice in a dose-dependent manner[5].
RSPO1/R-spondin-1, Human (100 ng/mL) enhances Wnt signaling (β-catenin nuclear accumulation) and induces alkaline phosphatase and osteoprotegerin (OPG) expression in mouse C2C12 mesenchymal cells and primary osteoblasts[7].

In Vivo

RSPO1/R-spondin-1, Human (0.8 mg/kg; i.p.; 80 days) maintains normoglycemia and improves glucose tolerance in Streptozotocin (HY-13753)-induced diabetic mice[5].
RSPO1/R-spondin-1, Human (3.3 μg/g; i.p.; daily; 7 days) increases bone mineralization deposition rate and promotes osteoblast differentiation in aging model mice (Terc-/-, Wrn-/-Terc-/-)[6].

Biological Activity

1.R-Spondin-1 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The expected ED50 is 0.5-3 μg/mL.
2.Measured by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells. The ED50 for this effect is 1-10 ng/mL

  • R-Spondin-1 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The expected ED50 is 2.232 μg/ml.corresponding to a specific activity is 4.48×10^2 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q2MKA7-1 (S21-A263)

Gene ID
Molecular Construction
N-term
RSPO1 (S21-A263)
Accession # Q2MKA7-1
6*His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
R-spondin-1; Roof plate-specific spondin-1; RSPO1
AA Sequence

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Predicted Molecular Mass
27.8 kDa
Molecular Weight

Approximately 40-43.3 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8.
3.Lyophilized from a 0.2 μm filtered solution of PBS, 8% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

RSPO1/R-spondin-1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RSPO1/R-spondin-1 Protein, Human (HEK293, His)
Cat. No.:
HY-P72784
Quantity:
MCE Japan Authorized Agent: