1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. RNF5 Protein, Human (Cell-Free, His)

The RNF5 protein is a membrane-bound E3 ubiquitin protein ligase that is critical for ubiquitination of target proteins and can cooperate with UBE2D1/UBCH5A and UBE2D2/UBC4 to achieve ubiquitination over a broad substrate range. Notably, it mediates PXN/paxillin ubiquitination, affecting cell motility and cell positioning. RNF5 Protein, Human (Cell-Free, His) is the recombinant human-derived RNF5 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RNF5 protein is a membrane-bound E3 ubiquitin protein ligase that is critical for ubiquitination of target proteins and can cooperate with UBE2D1/UBCH5A and UBE2D2/UBC4 to achieve ubiquitination over a broad substrate range. Notably, it mediates PXN/paxillin ubiquitination, affecting cell motility and cell positioning. RNF5 Protein, Human (Cell-Free, His) is the recombinant human-derived RNF5 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Background

RNF5 Protein, a membrane-bound E3 ubiquitin-protein ligase, plays a pivotal role in the ubiquitination of target proteins, exhibiting diverse cellular functions. Teaming up with E2 ubiquitin-conjugating enzymes such as UBE2D1/UBCH5A and UBE2D2/UBC4, RNF5 orchestrates ubiquitination processes with a broad substrate range. Notably, it mediates the ubiquitination of PXN/paxillin, influencing cell motility and the cellular localization of PXN/paxillin. Additionally, RNF5 catalyzes the ubiquitination of Salmonella type III secreted protein sopA and JKAMP, modulating their functions. The 'Lys-63'-linked polyubiquitination of JKAMP regulates its association with the proteasome and ERAD components, while the 'Lys-48'-linked polyubiquitination of STING1 at 'Lys-150' leads to proteasomal degradation, impacting antiviral responses. Furthermore, RNF5 catalyzes the ubiquitination and subsequent degradation of ATG4B, providing a mechanism to inhibit autophagy. These diverse activities highlight the versatile regulatory role of RNF5 in cellular processes.

Species

Human

Source

E. coli Cell-free

Tag

N-10*His

Accession

Q99942 (A2-I180)

Gene ID

6048

Molecular Construction
N-term
10*His
RNF5 (A2-I180)
Accession # Q99942
C-term
Protein Length

Full Length of Mature Protein

Synonyms
E3 ubiquitin-protein ligase RNF5; RING finger protein 5; Ram1 homolog; HsRma1
AA Sequence

AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI

Molecular Weight

27 kDa&54 kDa&108 kDa. It is speculated that the protein forms a multimer structure.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij-78, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RNF5 Protein, Human (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RNF5 Protein, Human (Cell-Free, His)
Cat. No.:
HY-P702425
Quantity:
MCE Japan Authorized Agent: