1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. RNASET2 Protein, Human (HEK293, His)

The RNASET2 protein is a ribonuclease that makes a crucial contribution to the innate immune response by degrading microbial RNA sensed by TLR8. It preferentially cleaves single-stranded RNA, generating products that promote RNA-dependent TLR8 activation. RNASET2 Protein, Human (HEK293, His) is the recombinant human-derived RNASET2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RNASET2 protein is a ribonuclease that makes a crucial contribution to the innate immune response by degrading microbial RNA sensed by TLR8. It preferentially cleaves single-stranded RNA, generating products that promote RNA-dependent TLR8 activation. RNASET2 Protein, Human (HEK293, His) is the recombinant human-derived RNASET2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The RNASET2 protein functions as a ribonuclease, playing a vital role in the innate immune response by recognizing and degrading RNAs from microbial pathogens, subsequently sensed by TLR8. This ribonuclease exhibits a preferential cleavage of single-stranded RNA molecules between purine and uridine residues, a process crucial for the supply of catabolic uridine and the generation of purine-2',3'-cyclophosphate-terminated oligoribonucleotides. These RNase T2 degradation products, in turn, actively promote the RNA-dependent activation of TLR8. Beyond its role in immune response, RNASET2 also plays a key role in the degradation of mitochondrial RNA and the processing of non-coding RNA imported from the cytosol into mitochondria. Additionally, it participates in the degradation of mitochondrion-associated cytosolic rRNAs, emphasizing its multifaceted involvement in RNA metabolism and immune regulation.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O00584 (D25-H256)

Gene ID
Molecular Construction
N-term
RNASET2 (D25-H256)
Accession # O00584
6*His
C-term
Synonyms
Ribonuclease T2; 3.1.27.-; Ribonuclease 6; RNASE6PL
AA Sequence

DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH

Molecular Weight

38-45 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 20% Glycerol, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

RNASET2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RNASET2 Protein, Human (HEK293, His)
Cat. No.:
HY-P71015
Quantity:
MCE Japan Authorized Agent: