Rnase 3 Protein, Human (HEK293, His)

Rnase 3 Protein, Human (HEK293, His) is the recombinant human-derived Rnase 3 protein, expressed by HEK293, with C-6*His labeled tag.

Rnase 3 is a cytotoxin and helminthotoxin with low-efficiency ribonuclease activity. It exhibits a wide range of biological activities, including antibacterial effects, preferentially targeting Gram-negative strains but also affecting Gram-positive strains by causing cytoplasmic membrane depolarization. Additionally, it promotes outer membrane detachment in E.coli, alters overall cell shape, and leads to partial loss of cellular content.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

C-6*His

AAH96060.1 (R28-I160)

6037  [NCBI]

Partial

RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

25-35 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris HCl, 150 mM NaCl, 1 mM DTT, 10% Glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.