1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Resistin Protein, Human (His)

Resistin, a hormone linking obesity to diabetes, may hinder insulin's glucose uptake stimulation in adipose cells, contributing to metabolic dysregulation. Additionally, it promotes myeloid cell chemotaxis and forms homodimers through disulfide linkages, interacting with DEFA1. Resistin's involvement in diverse cellular processes suggests its pivotal role in the complex interplay of metabolism, inflammation, and insulin responsiveness. Resistin Protein, Human (His) is the recombinant human-derived Resistin protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Resistin Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Resistin, a hormone linking obesity to diabetes, may hinder insulin's glucose uptake stimulation in adipose cells, contributing to metabolic dysregulation. Additionally, it promotes myeloid cell chemotaxis and forms homodimers through disulfide linkages, interacting with DEFA1. Resistin's involvement in diverse cellular processes suggests its pivotal role in the complex interplay of metabolism, inflammation, and insulin responsiveness. Resistin Protein, Human (His) is the recombinant human-derived Resistin protein, expressed by E. coli , with C-6*His labeled tag.

Background

Resistin, a hormone implicated in connecting obesity to diabetes, exerts its effects by potentially suppressing insulin's ability to stimulate glucose uptake into adipose cells. Not only does it play a role in metabolic regulation, but it also promotes chemotaxis in myeloid cells. Structurally, Resistin forms homodimers through disulfide linkages and interacts with DEFA1, indicating its involvement in diverse cellular processes. This multifaceted hormone emerges as a potential key player in the intricate interplay between metabolism, inflammation, and insulin responsiveness.

Biological Activity

Measured by its binding ability in a functional ELISA.Immobilized Human Resistin at 0.5 μg/mL (100μL/well) can bind Biotinylated Recombinant Mouse Leptin (HY-P7232). The ED50 for this effect is 79.14 ng/mL.

  • Measured by its binding ability in a functional ELISA.Immobilized Human Resistin at 0.5 μg/mL (100μL/well) can bind Biotinylated Recombinant Mouse Leptin (HY-P7232). The ED50 for this effect is 79.14 ng/mL.
Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q9HD89-1 (K19-P108)

Gene ID
Molecular Construction
N-term
Resistin (K19-P108)
Accession # Q9HD89-1
6*His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Resistin; Adipose tissue-specific secretory factor; Cysteine-rich secreted protein FIZZ3; C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; Cysteine-rich secreted protein A12-alpha-like 2; FIZZ3; HXCP1; RSTN; RETN
AA Sequence

KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP

Molecular Weight

10-14 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Acetic acid, pH 3.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Resistin Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Resistin Protein, Human (His)
Cat. No.:
HY-P71259
Quantity:
MCE Japan Authorized Agent: