1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Protease-activated Receptor
  5. Renin Protein, Human (HEK293, His)

Renin, a specialized endopeptidase, uniquely converts angiotensinogen to angiotensin I, initiating a cascade that elevates blood pressure and enhances kidney sodium retention. Renin's precision in initiating the angiotensin pathway underscores its pivotal role in regulating blood pressure and electrolyte balance. Renin Protein, Human (HEK293, His) is the recombinant human-derived Renin protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Renin, a specialized endopeptidase, uniquely converts angiotensinogen to angiotensin I, initiating a cascade that elevates blood pressure and enhances kidney sodium retention. Renin's precision in initiating the angiotensin pathway underscores its pivotal role in regulating blood pressure and electrolyte balance. Renin Protein, Human (HEK293, His) is the recombinant human-derived Renin protein, expressed by HEK293 , with C-10*His labeled tag.

Background

Renin, a specialized endopeptidase, serves a singular function in the conversion of angiotensinogen to angiotensin I within the plasma. This enzymatic activity sets off a series of reactions leading to an increase in blood pressure and enhanced sodium retention by the kidneys. Renin's precision in initiating the angiotensin pathway underscores its pivotal role in regulating blood pressure and electrolyte balance within the body.

Biological Activity

Measured by its ability to cleave substrateArg-Glu(EDANS)-Ile-His-Pro-Phe-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Lys(dabcyl)-Arg(HY-P5123A) that Incubate at 37 °C for 1 hour. The specific activity is ≥29.21 pmol/min/μg.

Species

Human

Source

HEK293

Tag

C-10*His

Accession

P00797-1 (L24-R406)

Gene ID
Molecular Construction
N-term
Renin (L24-R406)
Accession # P00797-1
10*His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein (with Propeptide)

Synonyms
Renin; Angiotensinogenase; REN
AA Sequence

LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR

Molecular Weight

43-50 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 8% Sucrose, 5% Mannitol, 0.05% Tween80, 100 mM NaCl, pH 7.4 or PBS, pH 7.4 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Renin Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Renin Protein, Human (HEK293, His)
Cat. No.:
HY-P71052
Quantity:
MCE Japan Authorized Agent: