1. Recombinant Proteins
  2. Others
  3. RecO Protein, E.coli (His-SUMO)

RecO protein, a crucial participant in DNA repair and the RecF pathway, operates as a monomer, contributing to the intricate choreography of DNA repair mechanisms and facilitating recombination. Its monomeric form underscores its singular involvement, highlighting its significance in orchestrating cellular responses to DNA damage and recombination. RecO Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecO protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RecO protein, a crucial participant in DNA repair and the RecF pathway, operates as a monomer, contributing to the intricate choreography of DNA repair mechanisms and facilitating recombination. Its monomeric form underscores its singular involvement, highlighting its significance in orchestrating cellular responses to DNA damage and recombination. RecO Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecO protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

RecO protein, a crucial participant in DNA repair and the RecF pathway of recombination, operates as a monomer to execute its functional role. In the intricate landscape of cellular processes, RecO emerges as a key actor, contributing to the intricate choreography of DNA repair mechanisms and facilitating recombination within the RecF pathway. Its monomeric form underscores its singular involvement, highlighting its significance in the orchestration of cellular responses to DNA damage and recombination events.

Species

E.coli

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

P0A7H3 (M1-E242)

Gene ID

947038  [NCBI]

Molecular Construction
N-term
6*His-SUMO
RecO (M1-E242)
Accession # P0A7H3
C-term
Protein Length

Full Length

Synonyms
recO; b2565; JW2549; DNA repair protein RecO; Recombination protein O
AA Sequence

MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE

Molecular Weight

Approximately 43.4 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RecO Protein, E.coli (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RecO Protein, E.coli (His-SUMO)
Cat. No.:
HY-P71512
Quantity:
MCE Japan Authorized Agent: