1. Recombinant Proteins
  2. Others
  3. RBM14 Protein, Human (His-SUMO)

The RBM14 protein has different isoforms with multiple functions. Isoform 1 enhances transcription as a nuclear receptor coactivator, interacting with NCOA6 and CITED1. RBM14 Protein, Human (His-SUMO) is the recombinant human-derived RBM14 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RBM14 protein has different isoforms with multiple functions. Isoform 1 enhances transcription as a nuclear receptor coactivator, interacting with NCOA6 and CITED1. RBM14 Protein, Human (His-SUMO) is the recombinant human-derived RBM14 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

RBM14 protein exhibits diverse functional roles depending on its isoform. Isoform 1 acts as a nuclear receptor coactivator, enhancing transcription through interactions with coactivators such as NCOA6 and CITED1. In contrast, Isoform 2 functions as a transcriptional repressor, modulating the activities of coactivators, including Isoform 1, NCOA6, and CITED1. Notably, RBM14 is implicated in the regulation of centriole biogenesis, where it suppresses the formation of aberrant centriolar protein complexes, ensuring the integrity of the mitotic spindle. Additionally, RBM14 plays a crucial role in the DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, serving as a platform for IRF3 phosphorylation and activating the innate immune response through the cGAS-STING pathway. Interactions with various proteins, including NCOA6, CITED1, XRCC5/KU86, SS18 isoforms, STIL, and gamma-tubulin, underscore its involvement in multiple cellular processes and signaling pathways. Furthermore, RBM14's incorporation into the HDP-RNP complex highlights its role in orchestrating innate immune responses against DNA viruses.

Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

Q96PK6 (M1-M669)

Gene ID
Molecular Construction
N-term
6*His-SUMO
RBM14 (M1-M669)
Accession # Q96PK6
C-term
Synonyms
RBM14; SIP; RNA-binding protein 14; Paraspeckle protein 2; PSP2; RNA-binding motif protein 14; RRM-containing coactivator activator/modulator; Synaptotagmin-interacting protein; SYT-interacting protein
AA Sequence

MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAASSLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQQAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASMGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQRRM

Molecular Weight

Approximately 85.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RBM14 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RBM14 Protein, Human (His-SUMO)
Cat. No.:
HY-P71612
Quantity:
MCE Japan Authorized Agent: