1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. RSPO1/R-spondin-1 Protein, Human (CHO, His)

RSPO1/R-spondin-1 is a potent activator of the Wnt/β-catenin signaling pathway and a secretory glycoprotein belonging to the R-spondin family. RSPO1 homotetramers synergize with LRP5/6 via LGR4/5/6 and activate the Wnt/β-catenin pathway by inhibiting DKK1/Kremen-mediated LRP6 endocytosis. RSPO1 promotes β-catenin nuclear translocation, drives HSC activation in liver fibrosis, inhibits adipocyte thermogenic gene expression, and promotes intestinal epithelial proliferation. RSPO1/R-spondin-1 Protein, Human (CHO, His) is a recombinant human RSPO1 protein expressed in CHO cells with a C-6*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

RSPO1/R-spondin-1 is a potent activator of the Wnt/β-catenin signaling pathway and a secretory glycoprotein belonging to the R-spondin family. RSPO1 homotetramers synergize with LRP5/6 via LGR4/5/6 and activate the Wnt/β-catenin pathway by inhibiting DKK1/Kremen-mediated LRP6 endocytosis. RSPO1 promotes β-catenin nuclear translocation, drives HSC activation in liver fibrosis, inhibits adipocyte thermogenic gene expression, and promotes intestinal epithelial proliferation[1][2][3][4]. RSPO1/R-spondin-1 Protein, Human (CHO, His) is a recombinant human RSPO1 protein expressed in CHO cells with a C-6*His tag.

Background

1. Protein characteristics of RSPO1/R-spondin-1
RSPO1/R-spondin-1, belonging to the R-Spondin (RSpo) secretory protein family (including RSPO1-4 members), is a potent activator of the Wnt/-catenin signaling pathway[1]. RSPO1/R-spondin-1 is a disulfide-linked secretory glycoprotein containing an N-terminal signal peptide, two furin-like domains (FR), a thrombin ospondin 1 domain (TSP1) and a C-terminal positively charged region. It binds to heparin sulfate proteoglycans (HSPGs) through electrostatic interactions to anchor the extracellular matrix[1][3].
The activity of R-spondin-1/RSPO1 depends largely on the presence of classical Wnt ligands and LRP6. Although R-spondin-1/RSPO1 does not directly activate LRP6, it can interfere with DKK1 function, regulate the turnover of LRP5 or LRP6 receptors and amplify Wnt-dependent signaling[2]. RSPO1/R-spondin-1 inhibits DKK1/Kremen-mediated LRP6 endocytosis, maintains cell surface LRP6 levels, and activates the Wnt/β-catenin pathway. After binding to LGR4/5/6, it releases the ubiquitination and degradation of Wnt receptors by ZNRF3/RNF43, promotes β-catenin nuclear translocation and TCF/LEF-dependent gene transcription[1][3].

2. Application of RSPO1/R-spondin-1
RSPO1/R-spondin-1 participates in the regulation of liver fibrosis: RSPO1/R-spondin-1 can promote the activation of hepatic stellate cells (HSC), upregulate α-SMA and Collagen-I, and drive fibrosis through the Wnt pathway[4].
RSPO1/R-spondin-1 inhibits fat metabolism: Wild-type RSPO1 enhances Wnt signaling through LGR4, inhibits adipocyte mitochondrial respiration and the expression of thermogenic genes (UCP1, PGC-1α), while the p.R219W mutation destroys HSPG binding, which leads to abnormal release and aggravates obesity[3].
RSPO1/R-spondin-1 promotes intestinal epithelial proliferation: RSPO1 promotes the proliferation of intestinal crypt stem cells through the Wnt pathway and repairs mucosal damage[2].

Biological Activity

1.R-Spondin-1 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The expected ED50 is 1.182 μg/mL.corresponding to a specific activity is 8.46 ×102 units/mg.
2.Measured by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells. The ED50 for this effect is 1-10 ng/mL.

  • R-Spondin-1 enhances BMP-2-mediated differentiation of MC3T3-E1 cells. The expected ED50 is 1.182 μg/ml.corresponding to a specific activity is  8.46 ×10^2 units/mg.
Species

Human

Source

CHO

Tag

C-6*His

Accession

Q2MKA7-1 (S21-A263)

Gene ID
Molecular Construction
N-term
RSPO1 (S21-A263)
Accession # Q2MKA7-1
6*His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
rHuR-spondin-1/RSPO1; Roof plate-specific spondin-1
AA Sequence

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Predicted Molecular Mass
27.8 kDa
Molecular Weight

Approximately 38-43.3 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4 or PBS,4%Mannitol,pH 7.4.

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

RSPO1/R-spondin-1 Protein, Human (CHO, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RSPO1/R-spondin-1 Protein, Human (CHO, His)
Cat. No.:
HY-P7114
Quantity:
MCE Japan Authorized Agent: