PVRIG Protein, Mouse (HEK293, Fc)

PVRIG Protein, a member of the nectin and nectin-like family, is an immune checkpoint molecule with potential for development. PVRIG binds with high affinity to PVRL2 are inhibitory receptors on effector T cells, suppressing cytokine production and cytotoxic activity. PVRIG blocking antibodies significantly increased NK-cell cytotoxicity. PVRIG Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PVRIG protein, expressed by HEK293 , with C-hFc labeled tag.

Poliovirus receptor related immunoglobulin domain containing (PVRIG), a member of the nectin and nectin-like family, is an immune checkpoint molecule with potential for development. In humans, PVRIG is expressed on T cells (predominantly CD8⁺ T cells) and natural killer (NK) cells, but not on B cells, monocytes or neutrophils. PVRIG binds to a single ligand, poliovirus receptor-related 2 (PVRL2), and exerts an inhibitory effect on cytotoxic lymphocyte activity, likely via an ITIM-like motif in its intracellular domain. PVRIG binds with high affinity to PVRL2 are inhibitory receptors on effector T cells, suppressing cytokine production and cytotoxic activity. PVRIG deficiency or PVRIG blockade can reduce the tumor size and prolong the survival of tumor-bearing mice through inhibiting NK cell and CD8⁺ T cell exhaustion. PVRIG blockade enhances natural killer cell killing of PVRL2hiPVRlo acute myeloid leukemia cells^[1][2][3].

Mouse

HEK293

C-hFc

A0A1B0GS01 (S35-D165)

102640920  [NCBI]

SPEVWVQVQMEATNLSSFSVHCGVLGYSLISLVTVSCEGFVDAGRTKLAVLHPEFGTQQWAPARQAHWETPNSVSVTLTMGQSKARSSLANTTFCCEFVTFPHGSRVACRDLHRSDPGLSAPTPALNLQAD

48-55 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.