1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. PVRIG
  5. PVRIG Protein, Mouse (HEK293, Fc)

PVRIG Protein, a member of the nectin and nectin-like family, is an immune checkpoint molecule with potential for development. PVRIG binds with high affinity to PVRL2 are inhibitory receptors on effector T cells, suppressing cytokine production and cytotoxic activity. PVRIG blocking antibodies significantly increased NK-cell cytotoxicity. PVRIG Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PVRIG protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PVRIG Protein, a member of the nectin and nectin-like family, is an immune checkpoint molecule with potential for development. PVRIG binds with high affinity to PVRL2 are inhibitory receptors on effector T cells, suppressing cytokine production and cytotoxic activity. PVRIG blocking antibodies significantly increased NK-cell cytotoxicity. PVRIG Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PVRIG protein, expressed by HEK293 , with C-hFc labeled tag.

Background

Poliovirus receptor related immunoglobulin domain containing (PVRIG), a member of the nectin and nectin-like family, is an immune checkpoint molecule with potential for development. In humans, PVRIG is expressed on T cells (predominantly CD8+ T cells) and natural killer (NK) cells, but not on B cells, monocytes or neutrophils. PVRIG binds to a single ligand, poliovirus receptor-related 2 (PVRL2), and exerts an inhibitory effect on cytotoxic lymphocyte activity, likely via an ITIM-like motif in its intracellular domain. PVRIG binds with high affinity to PVRL2 are inhibitory receptors on effector T cells, suppressing cytokine production and cytotoxic activity. PVRIG deficiency or PVRIG blockade can reduce the tumor size and prolong the survival of tumor-bearing mice through inhibiting NK cell and CD8+ T cell exhaustion. PVRIG blockade enhances natural killer cell killing of PVRL2hiPVRlo acute myeloid leukemia cells[1][2][3].

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

A0A1B0GS01 (S35-D165)

Gene ID
Molecular Construction
N-term
PVRIG (S35-D165)
Accession # A0A1B0GS01
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
C7orf15; CD112R; PVRIG; transmembrane protein PVRIG; C7orf15MGC138295; MGC104322; MGC138297; MGC2463
AA Sequence

SPEVWVQVQMEATNLSSFSVHCGVLGYSLISLVTVSCEGFVDAGRTKLAVLHPEFGTQQWAPARQAHWETPNSVSVTLTMGQSKARSSLANTTFCCEFVTFPHGSRVACRDLHRSDPGLSAPTPALNLQAD

Predicted Molecular Mass
41.1 kDa
Molecular Weight

Approximately 48-55 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PVRIG Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PVRIG Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P70961
Quantity:
MCE Japan Authorized Agent: