1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PTRH2 Protein, Human (His)

PTRH2, an enzyme with potential peptidyl-tRNA affinity, promotes caspase-independent apoptosis. It regulates transcriptional regulators AES and TLE1, contributing to the intricate machinery governing apoptotic processes. PTRH2 Protein, Human (His) is the recombinant human-derived PTRH2 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PTRH2, an enzyme with potential peptidyl-tRNA affinity, promotes caspase-independent apoptosis. It regulates transcriptional regulators AES and TLE1, contributing to the intricate machinery governing apoptotic processes. PTRH2 Protein, Human (His) is the recombinant human-derived PTRH2 protein, expressed by E. coli , with N-His labeled tag.

Background

PTRH2, an enzyme with a potential affinity for peptidyl-tRNAs that dissociate from the ribosome during protein synthesis, is implicated in the promotion of caspase-independent apoptosis. Its regulatory role extends to the modulation of two transcriptional regulators, AES and TLE1, contributing to the intricate machinery that governs apoptotic processes.

Biological Activity

Measured by its ability to inhibit chemoattract of A549 Human non-small cell lung cancer cells. The ED50 for this effect is 0.1557 μg/mL, corresponding to a specific activity is 6.422×103 U/mg.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9Y3E5 (G63-Y179)

Gene ID
Molecular Construction
N-term
His
PTRH2 (G63-Y179)
Accession # Q9Y3E5
C-term
Protein Length

Partial

Synonyms
Peptidyl-tRNA hydrolase 2, mitochondrial; PTH 2; BIT1; CGI-147
AA Sequence

GEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY

Molecular Weight

Approximately 14 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0, 10% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PTRH2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTRH2 Protein, Human (His)
Cat. No.:
HY-P76559
Quantity:
MCE Japan Authorized Agent: