1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PTPRZ1 Protein, Human (P.pastoris, His)

The PTPRZ1 protein is an important tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. It plays a crucial role in guiding the normal differentiation of precursor cells into mature oligodendrocytes and may act as an anti-apoptotic factor. PTPRZ1 Protein, Human (P.pastoris, His) is the recombinant human-derived PTPRZ1 protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PTPRZ1 protein is an important tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. It plays a crucial role in guiding the normal differentiation of precursor cells into mature oligodendrocytes and may act as an anti-apoptotic factor. PTPRZ1 Protein, Human (P.pastoris, His) is the recombinant human-derived PTPRZ1 protein, expressed by P. pastoris , with N-His labeled tag.

Background

PTPRZ1 protein, a pivotal protein tyrosine phosphatase, serves as a negative regulator of oligodendrocyte precursor proliferation within the embryonic spinal cord. Its essential role extends to the normal differentiation of precursor cells, guiding their transformation into mature, fully myelinating oligodendrocytes. Additionally, PTPRZ1 may act as a protective factor against apoptosis in oligodendrocytes. Beyond its involvement in oligodendrocyte function, PTPRZ1 is implicated in the establishment of contextual memory, potentially through the dephosphorylation of proteins within crucial signaling cascades. This multifaceted role underscores the significance of PTPRZ1 in the intricate processes of oligodendrocyte development and neural signaling, shedding light on its potential contributions to both cellular differentiation and memory formation.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

P. pastoris

Tag

N-His

Accession

P23471-1 (I36-Y300)

Gene ID
Molecular Construction
N-term
His
PTPRZ1 (I36-Y300)
Accession # P23471-1
C-term
Protein Length

Partial

Synonyms
3F8 chondroitin sulfate proteoglycan; 3H1 keratan sulfate proteoglycan; HPTPZ; HPTPzeta; Phosphacan; PTPRZ
AA Sequence

IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY

Molecular Weight

Approximately 35 kDa

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6%trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PTPRZ1 Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTPRZ1 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71777
Quantity:
MCE Japan Authorized Agent: