1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Peptide Hormone & Neuropeptides Cytokine Receptors
  4. PTH1R Protein, Human (HEK293, His)

PTH1R Protein, Human (HEK 293, His) is a recombinant PTH1R protein with a His-Flag. PTH1R plays an important role in skeletal development and homeostasis.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PTH1R Protein, Human (HEK 293, His) is a recombinant PTH1R protein with a His-Flag. PTH1R plays an important role in skeletal development and homeostasis[1].

Background

PTH1R belongs to the secretin class of G protein coupled receptors (GPCRs). PTH1R is involved in bone development and bone cell differentiation, and normally activated by parathyroid hormone (PTH) and parathyroid hormone-related peptide (PTHrP).
PTH1R that is mainly expressed in cells of the osteoblastic lineage。PTH1R regulates bone metabolism, signaling mainly through Gs and Gq/11 G-proteins.
PTH1R is a critical regulator of skeletal development and homeostasis[1][2].

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human PTH1R is used at 2 μg/mL, the concentration of biotinylated human PTHrP that produces 50% of the optimal binding response is found to 84.57 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human PTH1R is used at 2 μg/mL, the concentration of biotinylated human PTHrP that produces 50% of the optimal binding response is found to 84.57 ng/mL.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q03431 (Y23-M189)

Gene ID
Molecular Construction
N-term
PTH1R (Y23-M189)
Accession # Q03431
6*His
C-term
Protein Length

Partial

Synonyms
Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor; PTH/PTHr receptor; Parathyroid hormone 1 receptor; PTH1 receptor; PTH1R
AA Sequence

YALVDADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGM

Molecular Weight

25-35 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.The protein migrates as a 25-35 kDa band under reducing SDS-PAGE due to varying glycosylation.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

PTH1R Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTH1R Protein, Human (HEK293, His)
Cat. No.:
HY-P71244
Quantity:
MCE Japan Authorized Agent: