PSMA Protein, Human (HEK293, His, solution)

PSMA Protein is a type II transmembrane glycoprotein highly expressed on the surface of prostate cancer cells. PSMA Protein hydrolyzes extracellular polyglutamic acid folate into monoglutamic acid folate through folate hydrolase activity, improving the uptake efficiency of folate by tumor cells to support proliferation; and participates in neuropeptide metabolism through NAALADase activity. PSMA Protein, Human (HEK293, His, solution) is a recombinant PSMA protein expressed by HEK293 with an N-6*His tag.

PSMA Protein belongs to the M28 peptidase family^[1]. PSMA Protein is a type II transmembrane glycoprotein highly expressed on the surface of prostate cancer cells^{[1][2] [5]}. PSMA Protein hydrolyzes extracellular polyglutamic acid folate into monoglutamic acid folate through folate hydrolase activity, thereby increasing the efficiency of folate uptake by tumor cells to support proliferation; it participates in neuropeptide metabolism through NAALADase activity; its expression may mediate tumor angiogenesis by promoting integrin signaling^[1][5]. PSMA Protein is expressed at low levels in normal prostate epithelial cells, renal proximal tubules, central nervous system, small intestinal mucosal cells and salivary glands, and is significantly expressed at high levels in prostate cancer cells and neovascular endothelial cells of various solid tumors^[1][2][5]. PSMA Protein, Human is composed of 750 amino acid residues, including a 19-amino acid intracellular domain, a 24-amino acid transmembrane domain and a 707-amino acid extracellular domain. The extracellular domain contains 10 N-glycosylation sites. Glycosylation modification affects its stability and function^[1][4].

PSMA Protein, Human (transfected with pLNCX-PSMA plasmid into PC-3 cells) significantly promotes the proliferation of PC-3 cells^[1].

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

HEK293

N-6*His

Q04609-1 (K44-A750)

2346  [NCBI]

Extracellular Domain

KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

90-120 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, 5% Trehalose, pH 5.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Yao V, et al. Expression of prostate-specific membrane antigen (PSMA), increases cell folate uptake and proliferation and suggests a novel role for PSMA in the uptake of the non-polyglutamated folate, folic acid. Prostate. 2010 Feb 15;70(3):305-16.  [Content Brief]

  [2]. Kranzbühler B, et al. Pharmacological upregulation of prostate-specific membrane antigen (PSMA) expression in prostate cancer cells. Prostate. 2018 Jul;78(10):758-765.  [Content Brief]

  [3]. Hrkach J, et al. Preclinical development and clinical translation of a PSMA-targeted docetaxel nanoparticle with a differentiated pharmacological profile. Sci Transl Med. 2012 Apr 4;4(128):128ra39.  [Content Brief]

  [4]. Yuan W, et al. Glycoforms of human prostate-specific membrane antigen (PSMA) in human cells and prostate tissue. Prostate. 2022 Jan;82(1):132-144.  [Content Brief]

  [5]. Holmes EH. PSMA specific antibodies and their diagnostic and therapeutic use. Expert Opin Investig Drugs. 2001 Mar;10(3):511-9.  [Content Brief]