1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Carboxypeptidase
  4. PSMA Protein, Human (HEK293, His, solution)

PSMA Protein is a type II transmembrane glycoprotein highly expressed on the surface of prostate cancer cells. PSMA Protein hydrolyzes extracellular polyglutamic acid folate into monoglutamic acid folate through folate hydrolase activity, improving the uptake efficiency of folate by tumor cells to support proliferation; and participates in neuropeptide metabolism through NAALADase activity. PSMA Protein, Human (HEK293, His, solution) is a recombinant PSMA protein expressed by HEK293 with an N-6*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PSMA Protein is a type II transmembrane glycoprotein highly expressed on the surface of prostate cancer cells. PSMA Protein hydrolyzes extracellular polyglutamic acid folate into monoglutamic acid folate through folate hydrolase activity, improving the uptake efficiency of folate by tumor cells to support proliferation; and participates in neuropeptide metabolism through NAALADase activity. PSMA Protein, Human (HEK293, His, solution) is a recombinant PSMA protein expressed by HEK293 with an N-6*His tag.

Background

PSMA Protein belongs to the M28 peptidase family[1]. PSMA Protein is a type II transmembrane glycoprotein highly expressed on the surface of prostate cancer cells[1][2] [5]. PSMA Protein hydrolyzes extracellular polyglutamic acid folate into monoglutamic acid folate through folate hydrolase activity, thereby increasing the efficiency of folate uptake by tumor cells to support proliferation; it participates in neuropeptide metabolism through NAALADase activity; its expression may mediate tumor angiogenesis by promoting integrin signaling[1][5]. PSMA Protein is expressed at low levels in normal prostate epithelial cells, renal proximal tubules, central nervous system, small intestinal mucosal cells and salivary glands, and is significantly expressed at high levels in prostate cancer cells and neovascular endothelial cells of various solid tumors[1][2][5]. PSMA Protein, Human is composed of 750 amino acid residues, including a 19-amino acid intracellular domain, a 24-amino acid transmembrane domain and a 707-amino acid extracellular domain. The extracellular domain contains 10 N-glycosylation sites. Glycosylation modification affects its stability and function[1][4].

In Vitro

PSMA Protein, Human (transfected with pLNCX-PSMA plasmid into PC-3 cells) significantly promotes the proliferation of PC-3 cells[1].

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

N-6*His

Accession

Q04609-1 (K44-A750)

Gene ID
Molecular Construction
N-term
6*His
PSMA (K44-A750)
Accession # Q04609-1
C-term
Protein Length

Extracellular Domain

Synonyms
Glutamate carboxypeptidase 2; FGCP; GCPII; mGCP; NAALADase I; PSMA; Cell growth-inhibiting gene 27 protein; Folate hydrolase 1
AA Sequence

KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA

Molecular Weight

90-120 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM MES, 150 mM NaCl, 5% trehalose, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

PSMA Protein, Human (HEK293, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PSMA Protein, Human (HEK293, His, solution)
Cat. No.:
HY-P70548
Quantity:
MCE Japan Authorized Agent: