1. Recombinant Proteins
  2. Others
  3. PRTN3 Protein, Human (HEK293, C-His)

PRTN3 is a serine protease that broadly targets elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro, playing a crucial role in extracellular matrix degradation.It modulates endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2 and enhances vascular integrity during neutrophil transendothelial migration.PRTN3 Protein, Human (HEK293, C-His) is the recombinant human-derived PRTN3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRTN3 is a serine protease that broadly targets elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro, playing a crucial role in extracellular matrix degradation.It modulates endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2 and enhances vascular integrity during neutrophil transendothelial migration.PRTN3 Protein, Human (HEK293, C-His) is the recombinant human-derived PRTN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

PRTN3, a serine protease, exhibits a broad substrate specificity, targeting elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV in vitro. Its enzymatic activity plays a crucial role in the degradation of these extracellular matrix components. Additionally, PRTN3 takes part in the modulation of endothelial cell barrier function by cleaving and activating the receptor F2RL1/PAR-2, thereby enhancing vascular integrity during neutrophil transendothelial migration. Notably, its potential involvement in neutrophil transendothelial migration is suggested, particularly when associated with CD177, emphasizing its significance in immune-related processes.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P24158 (A26-R249)

Gene ID

5657

Molecular Construction
N-term
PRTN3 (A26-R249)
Accession # P24158
6*His
C-term
Protein Length

Partial

Synonyms
Myeloblastin; AGP7; C-ANCA Antigen; Leukocyte Proteinase 3; PR-3; PR3; Neutrophil Proteinase 4; NP-4; P29; Wegener Autoantigen; PRTN3; MBN
AA Sequence

AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRR

Molecular Weight

Approximately 34.0 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE..
Appearance

Oil

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 150 mM NaCl, pH 8.0, 10% glycerol, 10% trehalose, 0.02% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PRTN3 Protein, Human (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRTN3 Protein, Human (HEK293, C-His)
Cat. No.:
HY-P70509A
Quantity:
MCE Japan Authorized Agent: