1. Recombinant Proteins
  2. Viral Proteins Others
  3. Protein L1/VACWR088, Vaccinia virus (sf9, His, myc)

Protein L1/VACWR088, Vaccinia virus (sf9, His, myc)

Cat. No.: HY-P72300
Handling Instructions Technical Support

Protein L1/VACWR088 is a crucial part of the entry fusion complex (EFC) comprising 11 proteins. It facilitates the entry of the virion core into the host cytoplasm through a two-step process involving lipid mixing and pore formation. All EFC proteins, except OPG095/L1 and OPG053/F9, contribute to the assembly or stability of the complex. Protein L1/VACWR088, Vaccinia virus (sf9, His, myc) is the recombinant Virus-derived protein L1/VACWR088, expressed by sf9 insect cells , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Protein L1/VACWR088 is a crucial part of the entry fusion complex (EFC) comprising 11 proteins. It facilitates the entry of the virion core into the host cytoplasm through a two-step process involving lipid mixing and pore formation. All EFC proteins, except OPG095/L1 and OPG053/F9, contribute to the assembly or stability of the complex. Protein L1/VACWR088, Vaccinia virus (sf9, His, myc) is the recombinant Virus-derived protein L1/VACWR088, expressed by sf9 insect cells , with N-His, C-Myc labeled tag.

Background

Protein L1/VACWR088 serves as a crucial component of the entry fusion complex (EFC), a fundamental assembly comprising 11 proteins. During cell infection, this complex plays a pivotal role in facilitating the entry of the virion core into the host cytoplasm through a two-step mechanism involving lipid mixing of the viral and cellular membranes, followed by the formation of a pore. The EFC is orchestrated by a collaborative effort among its constituent proteins, namely OPG053/F9, OPG076/O3, OPG086/G3, OPG094/G9, OPG095/L1, OPG099/L5, OPG107/H2, OPG143/A16, OPG104/J5, OPG147/A21, and OPG155/A28. Remarkably, with the exception of OPG095/L1 and OPG053/F9, each protein within the EFC is indispensable for the assembly or stability of the complex.

Species

Virus

Source

Sf9 insect cells

Tag

N-His;C-Myc

Accession

P07612 (G2-G183)

Gene ID

3707544  [NCBI]

Molecular Construction
N-term
10*His
VACV L1 (G2-G183)
Accession # P07612
C-term
Protein Length

Partial

Synonyms
Virion membrane protein M25
AA Sequence

GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG

Molecular Weight

Approximately 26 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 3% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Protein L1/VACWR088, Vaccinia virus (sf9, His, myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Protein L1/VACWR088, Vaccinia virus (sf9, His, myc)
Cat. No.:
HY-P72300
Quantity:
MCE Japan Authorized Agent: