1. Recombinant Proteins
  2. Viral Proteins
  3. HPV Proteins
  4. HPV E7 Proteins
  5. Protein E7, HPV16 (His)

HPV16 E7 is a viral phosphoprotein with oncogenic activity, belonging to the human papillomavirus early protein family. HPV16 E7 activates the cell cycle by releasing E2F through proteasome degradation of pRB. HPV16 E7 can cooperate with E6 to immortalize cells and neutralize the toxicity of E5, while activating the AP-1/NF-κB pathway and downregulating E-cadherin to enhance migration and invasion, making it a core target for cervical cancer. Protein E7, HPV (His) is a recombinant HPV E7 protein expressed from E. coli with an N-6*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

HPV16 E7 is a viral phosphoprotein with oncogenic activity, belonging to the human papillomavirus early protein family. HPV16 E7 activates the cell cycle by releasing E2F through proteasome degradation of pRB. HPV16 E7 can cooperate with E6 to immortalize cells and neutralize the toxicity of E5, while activating the AP-1/NF-κB pathway and downregulating E-cadherin to enhance migration and invasion, making it a core target for cervical cancer. Protein E7, HPV (His) is a recombinant HPV E7 protein expressed from E. coli with an N-6*His tag.

Background

HPV16 E7 is a multifunctional nuclear phosphoprotein and a key oncoprotein in HPV16 carcinogenesis. It belongs to the human papillomavirus early protein family. The C-terminal half of HPV16 E7 contains two conserved Cys-X-X-Cys motifs, which can reversibly bind Zn2+ and Cd2+, significantly increase the α-helical content, and stabilize the hydrophobic core of the protein. The amino terminus of HPV16 E7 has sequence similarity with the adenovirus E1A protein and functional commonality with the SV40 large T antigen.
HPV16 E7 binds to the retinoblastoma protein (pRB) with high affinity, promotes its degradation through the proteasome pathway, and releases the transcription factor E2F to activate cell cycle progression. HPV16 E7 cooperates with the Ras oncogene to transform primary rodent cells. HPV16 E7 synergizes with E6 to immortalize primary human keratinocytes and neutralizes the cytotoxic effects of E5.
HPV16 E7 downregulates E-cadherin expression and enhances cell migration and invasion by activating AP-1 and NF-κB pathways. HPV16 E7 also disrupts cell adhesion and promotes epithelial-mesenchymal transition by interfering with cell-cell junctions and cytoskeletal rearrangement. Upstream regulatory factors of HPV16 E7 include viral promoters (such as LCR); downstream targets include pRB, E2F, p16 and E-cadherin, which can affect cell cycle control and adhesion molecule expression.
HPV16 E7 can be used to study the mechanism of action of cervical cancer development. The full-length E7 protein or E7 display vector (such as Lactobacillus casei) induces specific anti-tumor immunity in animal models such as TC-1 mice, inhibits tumor growth and improves survival rate. HPV16 E7 is the main target of HPV-related cancer therapeutic vaccines.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Protein E7 at 10 μg/mL (100 μL/well) can bind Biotinylated MYC. The ED50 for this effect is ≤0.3071 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Protein E7 at 10 μg/mL (100 μL/well) can bind Biotinylated MYC. The ED50 for this effect is 0.2398 μg/mL, corresponding to a specific activity is 4.17×103 Unit/mg.
Species

Virus

Source

E. coli

Tag

N-6*His

Accession

P03129 (M1-P98)

Gene ID

1489079  [NCBI]

Molecular Construction
N-term
6*His
Protein E7 (M1-P98)
Accession # P03129
C-term
Protein Length

Full Length

Synonyms
E7; Protein E7
AA Sequence

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Molecular Weight

Approximately 18-21 kDa

Purity
  • Greater than 94% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution in 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 or 50 mM Tris-HCl, 300 mM NaCl, pH 7.4 or PBS, 6% Trehalose, pH 7.4 or 50 mM Tris-HCl, 200 mM NaCl, pH 8.0 or 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 8% trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Protein E7, HPV16 (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Protein E7, HPV16 (His)
Cat. No.:
HY-P72259
Quantity:
MCE Japan Authorized Agent: