1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Prolactin
  5. Prolactin Protein, Human (SF9, His)

Prolactin Protein acts on the mammary gland, promoting lactation through its interaction with the receptor PRLR. Prolactin Protein, Human (SF9, His) is the recombinant human-derived Prolactin protein, expressed by Sf9 insect cells , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Prolactin Protein acts on the mammary gland, promoting lactation through its interaction with the receptor PRLR. Prolactin Protein, Human (SF9, His) is the recombinant human-derived Prolactin protein, expressed by Sf9 insect cells , with C-10*His labeled tag.

Background

Prolactin is a protein that primarily acts on the mammary gland by promoting lactation. It achieves this by interacting with its receptor, PRLR.

Biological Activity

1.Measured by its ability to promote proliferation of INS-1 cells and the ED50 is typically 5.6 ng/mL.
2.Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.6-1.0 ng/mL.

  • Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.8715 ng/mL, corresponding to a specific activity is 1.147×106 U/mg.
Species

Human

Source

Sf9 insect cells

Tag

C-10*His

Accession

P01236 (L29-C227)

Gene ID
Molecular Construction
N-term
Prolactin (L29-C227)
Accession # P01236
10*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
PRL; Prolactin
AA Sequence

LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Molecular Weight

Approximately 26 kDa, due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% Glycerol, pH 8.0 or 20 mM Tris-HCL, 500 mM NaCl, pH 8.0, 20% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Prolactin Protein, Human (SF9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Prolactin Protein, Human (SF9, His)
Cat. No.:
HY-P73380
Quantity:
MCE Japan Authorized Agent: