Prokineticin-1/EG-VEGF Protein, Human

Prokineticin-1/EG-VEGF protein is a potent regulator of gastrointestinal smooth muscle contraction and affects intestinal motility. Its multifaceted effects extend to capillary endothelial cells, inducing proliferation, migration, and fenestration and are specific to certain cell types. Prokineticin-1/EG-VEGF Protein, Human is the recombinant human-derived Prokineticin-1/EG-VEGF protein, expressed by E. coli , with tag free.

Prokineticin-1/EG-VEGF Protein stands out as a potent regulator of gastrointestinal (GI) smooth muscle contraction, highlighting its role in modulating gut motility. Beyond its influence on smooth muscle, this protein exhibits a multifaceted impact on capillary endothelial cells derived from endocrine glands, inducing proliferation, migration, and fenestration. Importantly, Prokineticin-1/EG-VEGF demonstrates specificity by having little or no effect on various other endothelial and non-endothelial cell types. Its role extends to the enteric neural crest cells, where it induces proliferation and differentiation. In neuroblastoma progression, this protein directly influences the proliferation and migration of neuroblastoma cells, implicating its involvement in tumor dynamics. Additionally, Prokineticin-1/EG-VEGF positively regulates PTGS2 expression and prostaglandin synthesis, suggesting a potential role in inflammatory responses. With implications in placentation and normal as well as pathological testis angiogenesis, Prokineticin-1/EG-VEGF emerges as a versatile signaling molecule with diverse cellular effects across various physiological and pathological contexts.

Human

E. coli

Tag Free

P58294 (A20-F105)

84432  [NCBI]

Full Length of Mature Protein

AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.