1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. Prokineticin-1/EG-VEGF Protein, Human

Prokineticin-1/EG-VEGF protein is a potent regulator of gastrointestinal smooth muscle contraction and affects intestinal motility. Its multifaceted effects extend to capillary endothelial cells, inducing proliferation, migration, and fenestration and are specific to certain cell types. Prokineticin-1/EG-VEGF Protein, Human is the recombinant human-derived Prokineticin-1/EG-VEGF protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Prokineticin-1/EG-VEGF protein is a potent regulator of gastrointestinal smooth muscle contraction and affects intestinal motility. Its multifaceted effects extend to capillary endothelial cells, inducing proliferation, migration, and fenestration and are specific to certain cell types. Prokineticin-1/EG-VEGF Protein, Human is the recombinant human-derived Prokineticin-1/EG-VEGF protein, expressed by E. coli , with tag free.

Background

Prokineticin-1/EG-VEGF Protein stands out as a potent regulator of gastrointestinal (GI) smooth muscle contraction, highlighting its role in modulating gut motility. Beyond its influence on smooth muscle, this protein exhibits a multifaceted impact on capillary endothelial cells derived from endocrine glands, inducing proliferation, migration, and fenestration. Importantly, Prokineticin-1/EG-VEGF demonstrates specificity by having little or no effect on various other endothelial and non-endothelial cell types. Its role extends to the enteric neural crest cells, where it induces proliferation and differentiation. In neuroblastoma progression, this protein directly influences the proliferation and migration of neuroblastoma cells, implicating its involvement in tumor dynamics. Additionally, Prokineticin-1/EG-VEGF positively regulates PTGS2 expression and prostaglandin synthesis, suggesting a potential role in inflammatory responses. With implications in placentation and normal as well as pathological testis angiogenesis, Prokineticin-1/EG-VEGF emerges as a versatile signaling molecule with diverse cellular effects across various physiological and pathological contexts.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human EG-VEGF at 2 μg/mL can bind Anti-EG-VEGF antibody. The ED50 for this effect is 42.32 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human EG-VEGF at 2 μg/mL can bind Anti-EG-VEGF antibody. The ED50 for this effect is 42.32 ng/mL.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P58294 (A20-F105)

Gene ID
Molecular Construction
N-term
EG-VEGF (A20-F105)
Accession # P58294
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Black mamba toxin related protein; EG VEGF; EG-VEGF; EGVEGF; Endocrine-gland-derived vascular endothelial growth factor; Mambakine; PK1; PRK1; PROK1; PROK1_HUMAN; Prokineticin 1; Prokineticin-1
AA Sequence

AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF

Predicted Molecular Mass
9.7 kDa
Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 0.02% Tween20, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Prokineticin-1/EG-VEGF Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Prokineticin-1/EG-VEGF Protein, Human
Cat. No.:
HY-P71906
Quantity:
MCE Japan Authorized Agent: