1. Recombinant Proteins
  2. Others
  3. PRAP1 Protein, Human (HEK293, His)

Proline-rich acidic protein 1 (PRAP1) is a lipid-binding protein which promotes lipid absorption; negatively regulates the apoptotic process; gets involved in p53/TP53-dependent cell survival after DNA damage; causes cell cycle arrest; maintains normal growth homeostasis in epithelial cells and suppress mitotic spindle assembly checkpoint in hepatocellular carcinomas. PRAP1 Protein, Human (HEK293, His) is the recombinant human-derived PRAP1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Proline-rich acidic protein 1 (PRAP1) is a lipid-binding protein which promotes lipid absorption; negatively regulates the apoptotic process; gets involved in p53/TP53-dependent cell survival after DNA damage; causes cell cycle arrest; maintains normal growth homeostasis in epithelial cells and suppress mitotic spindle assembly checkpoint in hepatocellular carcinomas. PRAP1 Protein, Human (HEK293, His) is the recombinant human-derived PRAP1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Proline-rich acidic protein 1 (PRAP1) is a lipid-binding protein which promotes lipid absorption by facilitating MTTP-mediated lipid transfer (mainly triglycerides and phospholipids) and MTTP-mediated apoB lipoprotein assembly and secretion. PRAP1 also negatively regulates the apoptotic process, gets involved in p53/TP53-dependent cell survival after DNA damage and may cause cell cycle arrest. PRAP1 may play an important role in maintaining normal growth homeostasis in epithelial cells and may down-regulate the expression of MAD1L1, exerting a suppressive role in mitotic spindle assembly checkpoint in hepatocellular carcinomas[1][2][3].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q96NZ9/AAL16670.1 (V21-Q151)

Gene ID
Molecular Construction
N-term
PRAP1 (V21-Q151)
Accession # Q96NZ9/AAL16670.1
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Proline-Rich Acidic Protein 1; Epididymis Tissue Protein Li 178; Uterine-Specific Proline-Rich Acidic Protein; PRAP1; UPA
AA Sequence

VPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ

Molecular Weight

Approximately 20.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

PRAP1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRAP1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71004
Quantity:
MCE Japan Authorized Agent: