1. Recombinant Proteins
  2. Receptor Proteins
  3. Nuclear Receptor Superfamily
  4. Peroxisome Proliferator-activated Receptor
  5. PPAR-delta
  6. PPARD Protein, Human (His)

PPARD protein is a ligand-activated transcription factor that critically mediates energy metabolism in adipose tissue. As a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, and preferentially binds polyunsaturated substances. PPARD Protein, Human (His) is the recombinant human-derived PPARD protein, expressed by E. coli, with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PPARD protein is a ligand-activated transcription factor that critically mediates energy metabolism in adipose tissue. As a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, and preferentially binds polyunsaturated substances. PPARD Protein, Human (His) is the recombinant human-derived PPARD protein, expressed by E. coli, with N-6*His labeled tag.

Background

PPARD protein, a ligand-activated transcription factor, stands as a crucial mediator of energy metabolism within adipose tissues. Functioning as a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, with a preference for polyunsaturated fatty acids such as gamma-linoleic acid and eicosapentaenoic acid. Upon ligand activation, the receptor engages with promoter elements of target genes, regulating the peroxisomal beta-oxidation pathway of fatty acids and serving as a transcription activator for the acyl-CoA oxidase gene. Additionally, it plays a role in decreasing the expression of NPC1L1 upon ligand activation. PPARD forms a heterodimer with the retinoid X receptor and interacts with CRY1 and CRY2 in a ligand-dependent manner via its NR LBD domain.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q03181 (Q171-Y441)

Gene ID

5467

Molecular Construction
N-term
6*His
PPARD (Q171-Y441)
Accession # Q03181
C-term
Protein Length

Partial

Synonyms
FAAR; MGC3931; NR1C2; NUC1; NUCI; NUCII; Nuclear hormone receptor 1; Nuclear receptor subfamily 1 group C member 2; Peroxisome proliferative activated receptor delta; Peroxisome proliferator-activated receptor beta (PPAR-beta); Peroxisome proliferator-activated receptor beta; Peroxisome proliferator-activated receptor delta; PPAR beta; PPAR-beta; PPAR-delta; PPARB; ppard; PPARD_HUMAN
AA Sequence

QVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

Predicted Molecular Mass
35.1 kDa
Molecular Weight

Approximately 34 kDa, based on SDS-PAGE under reducing conditions.

Structure/Form
Monomer
Purity

Greater than 85% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PPARD Protein, Human (His)
Cat. No.:
HY-P704244
Quantity:
MCE Japan Authorized Agent: