PPARD Protein, Human (HEK293, His)

PPARD protein is a ligand-activated transcription factor that critically mediates energy metabolism in adipose tissue. As a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, and preferentially binds polyunsaturated substances. PPARD Protein, Human (HEK293, His) is the recombinant human-derived PPARD protein, expressed by HEK293, with C-6*His labeled tag.

PPARD protein, a ligand-activated transcription factor, stands as a crucial mediator of energy metabolism within adipose tissues. Functioning as a receptor, it selectively binds peroxisome proliferators, including hypolipidemic drugs and fatty acids, with a preference for polyunsaturated fatty acids such as gamma-linoleic acid and eicosapentaenoic acid. Upon ligand activation, the receptor engages with promoter elements of target genes, regulating the peroxisomal beta-oxidation pathway of fatty acids and serving as a transcription activator for the acyl-CoA oxidase gene. Additionally, it plays a role in decreasing the expression of NPC1L1 upon ligand activation. PPARD forms a heterodimer with the retinoid X receptor and interacts with CRY1 and CRY2 in a ligand-dependent manner via its NR LBD domain.

Human

HEK293

C-6*His

Q03181-1 (M1-Y441)

5467

Full Length of Isoform-1

MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY

Approximately 56-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.