1. Recombinant Proteins
  2. Receptor Proteins
  3. Nuclear Receptor Superfamily
  4. Peroxisome Proliferator-activated Receptor
  5. PPAR gamma
  6. PPAR gamma Protein, Human (His)

PPAR gamma LBD Protein, Human (His) is a His-fused PPAR-gamma-LBD protein expressed by E. coli, approximately 32.6 kDa. PPAR gamma LBD Protein can be used in the ligand screening assays, western blotting, and ELISA, et al.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg Get quote
250 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PPAR gamma LBD Protein, Human (His) is a His-fused PPAR-gamma-LBD protein expressed by E. coli, approximately 32.6 kDa. PPAR gamma LBD Protein can be used in the ligand screening assays, western blotting, and ELISA, et al[1].

Background

The peroxisome proliferator-activated receptor (PPAR) belongs to the nuclear receptor superfamily and plays an important role in the regulation of the storage and catabolism of dietary fats. PPAR contains three subtypes, PPARα, PPARβand PPARγ[1].
Many naturally occurring molecules such as; polyunsaturated fatty acids like arachidonic acid and arachidonic acid metabolites such as; polyunsaturated fatty acids like arachidonic acid and arachidonic acid metabolites can bind and activate PPARgamma[2].
LBD is the ligand binding domain (LBD) of PPARgamma, His-taged LBD can be used for the study of ligand screening assays, western blotting, and ELISA, et al.

Biological Activity

PPAR gama immobilized on CM5 Chip can bind GW9662 (HY-16578) with an affinity constant of 18.56 μM as determined in SPR assay.

  • PPAR gama immobilized on CM5 Chip can bind GW9662 (HY-16578) with an affinity constant of 18.56 μM as determined in SPR assay.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P37231-1 (D238-D503)

Gene ID
Molecular Construction
N-term
6*His
PPAR gamma (D238-D503)
Accession # P37231-1
C-term
Synonyms
PPAR-γ-LBD
AA Sequence

DLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD

Molecular Weight

Approximately 30-32.6 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 8.0 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PPAR gamma Protein, Human (His)
Cat. No.:
HY-P7999
Quantity:
MCE Japan Authorized Agent: