1. Recombinant Proteins
  2. Others
  3. PODXL Protein, Human (P.pastoris, His)

PODXL proteins coordinate multiple cellular functions, acting as anti-adhesion and pro-adhesion molecules. In podocytes, it maintains open filtration pathways through charge repulsion and promotes migration and cell-cell contacts in an integrin-dependent manner. PODXL Protein, Human (P.pastoris, His) is the recombinant human-derived PODXL protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PODXL proteins coordinate multiple cellular functions, acting as anti-adhesion and pro-adhesion molecules. In podocytes, it maintains open filtration pathways through charge repulsion and promotes migration and cell-cell contacts in an integrin-dependent manner. PODXL Protein, Human (P.pastoris, His) is the recombinant human-derived PODXL protein, expressed by P. pastoris , with N-His labeled tag.

Background

The PODXL Protein plays a multifaceted role in the regulation of adhesion, cell morphology, and cancer progression. Functioning as an anti-adhesive molecule, PODXL maintains an open filtration pathway between neighboring foot processes in the podocyte through charge repulsion. Simultaneously, it acts as a pro-adhesive molecule, enhancing cell adherence to immobilized ligands, promoting migration, and facilitating cell-cell contacts in an integrin-dependent manner. PODXL induces the formation of apical actin-dependent microvilli and is crucial for the establishment of initial epithelial polarization and apical lumen formation during renal tubulogenesis. In cancer, PODXL contributes to cell migration and invasion by interacting with the actin-binding protein EZR, affecting EZR-dependent signaling events that lead to increased activities of the MAPK and PI3K pathways. Its oligomeric state varies, existing as a monomer when associated with membrane rafts and forming oligomers when integrated into the apical membrane. PODXL's interactions with NHERF1, NHERF2, and EZR highlight its dynamic role in cellular processes and its importance in diverse cellular contexts.

Species

Human

Source

P. pastoris

Tag

N-His

Accession

O00592-1 (Q32-F458)

Gene ID
Molecular Construction
N-term
His
PODXL (Q32-F458)
Accession # O00592-1
C-term
Protein Length

Partial

Synonyms
GCTM-2 antigen; Gp2; Gp200; PCLP1; Pcx; Podocalyxin; Podocalyxin like; Podocalyxin like protein; Podocalyxin-like protein 1; Podxl
AA Sequence

QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRF

Molecular Weight

Approximately 120 kDa

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 6% trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PODXL Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PODXL Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71814
Quantity:
MCE Japan Authorized Agent: