1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PNGase F Protein, F. meningosepticum (His)

The PNGase F protein acts as an enzyme catalyst that specifically cleaves entire glycans from glycoproteins. This process depends on the replacement of the glycosylated asparagine moiety by a polypeptide chain at both its amino (R1) and carboxyl (R2) termini, as shown in Reaction 1. PNGase F Protein, F. meningosepticum (His) is the recombinant PNGase F protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PNGase F protein acts as an enzyme catalyst that specifically cleaves entire glycans from glycoproteins. This process depends on the replacement of the glycosylated asparagine moiety by a polypeptide chain at both its amino (R1) and carboxyl (R2) termini, as shown in Reaction 1. PNGase F Protein, F. meningosepticum (His) is the recombinant PNGase F protein, expressed by E. coli , with N-His labeled tag.

Background

PNGase F (Peptide:N-glycosidase F) is a protein with the remarkable ability to cleave an entire glycan from a glycoprotein. This enzymatic process involves the removal of the glycosylated asparagine moiety, specifically requiring that the asparagine be substituted on both its amino (R1) and carboxyl (R2) termini with a polypeptide chain. PNGase F plays a pivotal role in the analysis and manipulation of glycoproteins by facilitating the release of N-linked glycans. This enzymatic activity is crucial for various applications in the study of protein glycosylation, allowing researchers to investigate the structural and functional implications of glycan modifications on proteins (

Biological Activity

Measured by its ability to deglycosylate ribonuclease B under denatured conditions. >50% ribonuclease B (10 μg) is deglycosylated by approximately 1.5-2.5 ng rFmPNGase F within 30-60 minutes, the conditions should be optimized based on individual experiments.

Species

Others

Source

E. coli

Tag

N-6*His

Accession

P21163 (A41-N354)

Gene ID

/

Molecular Construction
N-term
6*His
PNGase F (A41-N354)
Accession # P21163
C-term
Protein Length

Full Length of Mature Protein

Synonyms
PNGase F; PNGF; Peptide-N4-(N-acetyl-beta-D-glucosaminyl)asparagine Amidase F
AA Sequence

APADNTVNIKTFDKVKNAFGDGLSQSAEGTFTFPADVTTVKTIKMFIKNECPNKTCDEWDRYANVYVKNKTTGEWYEIGRFITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKGREYSVDFDIVYGTPDYKYSAVVPVIQYNKSSIDGVPYGKAHTLGLKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQHQLGALGCSANPINNQSPGNWAPDRAGWCPGMAVPTRIDVLNNSLTGSTFSYEYKFQSWTNNGTNGDAFYAISSFVIAKSNTPISAPVVTN

Molecular Weight

Approximately 35 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4, 10% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PNGase F Protein, F. meningosepticum (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PNGase F Protein, F. meningosepticum (His)
Cat. No.:
HY-P79356
Quantity:
MCE Japan Authorized Agent: